datasheet

电子工程世界电子工程世界电子工程世界

型号

产品描述

搜索

HR1206F-180MJI

器件型号:HR1206F-180MJI
器件类别:无源元件   
厂商名称:TT Electronics
下载文档

器件描述

Thick Film Resistors - SMD

参数

产品属性属性值
Product AttributeAttribute Value
制造商:
Manufacturer:
TT Electronics
产品种类:
Product Category:
Thick Film Resistors - SMD
系列:
Series:
HR
电阻:
Resistance:
180 MOhms
容差:
Tolerance:
5 %
温度系数:
Temperature Coefficient:
- 1000 PPM / C, 0 PPM / C
最小工作温度:
Minimum Operating Temperature:
- 55 C
最大工作温度:
Maximum Operating Temperature:
+ 155 C
电压额定值:
Voltage Rating:
200 V
外壳代码 - in:
Case Code - in:
1206
外壳代码 - mm:
Case Code - mm:
3216
高度:
Height:
0.7 mm
长度:
Length:
3.2 mm
封装 / 箱体:
Package / Case:
1206 (3216 metric)
产品:
Product:
Thick Film Resistors SMD
技术:
Technology:
Thick Film
端接类型:
Termination Style:
SMD/SMT
宽度:
Width:
1.6 mm
商标:
Brand:
Welwyn Components / TT Electronics
安装风格:
Mounting Style:
PCB Mount
产品类型:
Product Type:
Thick Film Resistors
子类别:
Subcategory:
Resistors

HR1206F-180MJI器件文档内容

                              High Value Surface
        HRHMHMeiiigoosggHMihuushhMitonngVoVVouhttraeesaaunlVuddlltnuueaeteeRRdleuSdeeSSueRssruueRSfiissrraseuffttciaasoorsefcctirrasosseectrosers
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      Welwyn Components

        Mounted Resistors HR Series                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            WWWWeeelllewwwlwyyynnnynCCCCoooommmmppppoooonnnneeeennnntttsssts

        HH•••H•••H••••••RRRRRTLRTLRTLoooCCCCRTSeeeeoooeeeerrruSSSuuuerrrrwswwwssssrsssmeeemmmitsssH••••iiiisoooorrrsssevttttiiiiRiiivvvtttnlllmseeeoannnRTLoCoooddd••••aaaoooanlssseoertaaaSeeennnutmmmdclllarwisRTLoCttttttsrrreemcccoegsiiiieaaaoiiioereeersoooenunnntrirgggivtwliesadddssnnnngodmgggacrrrsoieeesnonosaaaaassseneeemtlgivtsvlettnnncccrncodaaaesssaiaaoifooo/eogggnafvvveiniiigmtilleeedsngggeeegctaotaaarceifffiiaaizbseeiiieonnnfffn5tttelllgnlciiinaaadooose0nsgcccosssrgetvbbbiGiiiasfeaeg555eeeeooallln///vcfeeeaos000nnnfrinaoftglhvGGGiirtttsssaoiwfffeclsgeemaabiiioooiooofis5ezzzooobrinlfrrr/sitlfffees0nlieeeahhhoectswwwGrrrtsbbammmfissseee5eioonoliii/zsssoerrr0sssnncraaafiiieeeeheGdssstswfrvvvtttmisioebbbonaaazaaaoisrooogrsfnnnaieheiiisnnnwocccrlllvmtsaaaeeeebdddraaisosiiirsbbbnannniieonscllllvggglateddeeebaaeibonrilnigclneaedgibnlge

                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  All Pb-free parts comply with EU Directive 2011/65/EU (RoHS2)

                              Electrical Data

        EEEllleeecccEtttrrrlPTeiiihcccoecwaaahteirglllrhicDDDRreaasaaatislittttnaDaaangcae vtaalue of these devices is such that power dissipation is always small. The rating is therefore determined by
        PTPTPTPTvvvvoooohhhhoooolllleeeettttwwwwaaaahhhhggggeeeeiiiieeeeggggrrrrPThhhhvccccohoRRRRoooorrrrleteeeennnnwvaaaaassssohssssRgttttiiiiiiiiessssilddddeiiiiegtttttnnnnasreeeeaaaahicgsrrrrnnnnggggRotaaaareaccccenttttaneeeeiiiisscooootciiosdvvvveinnnntnaaaaeassssrllllsrngauuuuaooooindceeeetnnnnegieolllleooooryyyyvn*a,,,,ffffastaaaalttttiuoohhhhssssenneeeesssslsssssohhhhyeeee,foooooawwwwtddddnhseeeelnnnneysvvvv,shiiiiiiiieccccannnnoeeeeswdssssttttoeshhhhnhiiiihvsssseeeemioicn0ssssttttsweuuuuaaaa5stccccbbbbn0hihhhh3llllseeeeeinsttttt1bbbbhhhhuat0eeeecaaaabhMhllllttttooooee0ppppwwwwt5ttbhooooo0a....eawwww3b2ltol0eeeeepwGrrrrob.ddddweiiii0sssselossss6riiiiw0ppppd3.aaaaisttttsiiiiioooopnnnna0t8iiiiisssso0n5aaaalllliwwwws aaaaayyyyl0wssss8assss0ymmmm5s1aaaas0llllmllll0.... aMTTTT1lhhhhl0.t0eeeeoT5hrrrr51aaaae00ttttGiiiir0nnnna5ggggtiniiiissssg
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   ttttihhhhs eeeethrrrreeee1effff2rooooe0rrrrf6eeeeorddddeeeeedtttteeeeetrrrremmmmrmiiiinnnnieeeenddddedbbbbbyyyyNyotes

                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 1206            MNeoatseusred at 10                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     volts

        Physical Data ****RARLTHHHHTRTRTRTRRRRRAAAALLLLiCeemmiiiiCCCCeeeeeeeemmmmmmmmiiiiRssggggssssssssRRRRbiii         iiiiiiiibbbbiiiisshhhhtssssssssttttiittttttttttiiiiiiiieeeeeneeeennnaaaaaaaaaanrrrrnnnngggg         nnnnnnnnnn*tttttccccccccvvvvHccTRRALeeeeeeeeeeeetaaaaeettttiCeelmmillleeeee*eeeegllllssRttttrrrruuuurtmmmmmmmmmiibHimooooaaaahTRALssaoteeeettiiinnnnClllleeppppnenmmipeeeeleeeeaaessssgeggggsreeeenRnnnngnnrrrrgenibirhaaaaeeeerrrrtsaaaatttttccevraaaaaettiinnnn****eeeavvvvaten*vvvvattttnleccccveaaaartnluuuuoooogntrumeeeecumooaiiiitrrrrllllcvlllletttteeeeeenrlaaaalpeaaaaaetetselgebbbbeenggggarrrrrltuaemaaaaramtrlllleeeegoaeeeen*nnnnaevevlpte,,,,ceggggansuoeenreeeeiccccrglalrtaetaooooaeanvbvgtrnnnncauaoppppleessssenirplpppluuuute,agooooapmmmmllllvvvvebcohhhhgttttrmoooova////ommmmlhe°°°°°°°°ffff%%%%ellllonntttt/CCCCCCCCaaaamsssspssss,gl°s°cccc%tpCCeucssttttomooooolvht1111onrrrr/>>>>m°°00001pf%yyyylst5555CCa1111>MMMMp0ssu00000000ffffc00005mMoooolvt00000tMMMM0ttttttttoorrrr/MMMMoooo0000oooo1°°0f%trtl>tdddd55555555CC0ayoottttM----s55551oooo00000000M::::eeeec2222500000f-503333t:2222tttt55550o222220000o0aaaaMtt255550000r510000MoMMM0o0iiiir>,,,,50000llll00GGGGyd55ssssMt5-55555,::::0Mo00:e21111100f05000032:t500000o20010a5t0tMr0MMo0oi,0lGsd55:-5t10:e20o002t510>a20000500M1i0,0MlttttGsG5oooo0000:11111008888t00000----:0o111100002222000010000555570000t10o00000500001G----8,MMMM555500000-0102255550005:500tttt5tttt0toooo0,-oooo,otM505o1111151++++0-0GGGG2t0-t1o211110::::0o111155550055550100000000,,,,+0055550-1111G0000M50tttt000011-:MMMM15oooo111155501111000000t,5505555t----1o0tttt10000o1111oooot0000M0>>>>Mt05555o155551o1+0555500000G11115-tt0+000010000GGGG1oo0:>51GGGG55551005,tttt151oooo0G05Gt0Go:555511t50000o05-,GGGG0100>515::::M0000t02222001oG155550ttttGtoooo1111-5:,,,,>022222o12222055551t00005----5to0000511110000Go1,00000266660000025500-t0000G0100o0000060G50:00020G5to,t:2o5220-MMMMMMMM10-050100,eeeeeeeeMM005aaaaaaaa00eessssssss0uuuuuuuu0aassrrrrrrrrNNNNueeeeueeeeddddddddrrooooNeeddttttaaaaaaaaMMaaoeeeettttttttMtttaasssseee11111111tt11eaas000000005511ass00vvsuuvvvvvvvvuoooooooooorrvvrlleelllllllooetttttttttddssssssssslldttssat         10                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             volts

        PPPhhhyyysssPiiihcccDyaaaimsllleincDDDsiaoaaanlsttt(Daaamma)t&aWeight (g)                                                                                                                                                                      Wrap around                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                Planar
                              Dimensions (mm) & Weight (g)

        DDS0011DS0011DS0011DS0011S00011itttt5802580258025802miiiityyyy56802mmmm0000000000000000yllll00000eeeee3556355635563556leeee33556ennnnns†ssssiToiiiiS0011hoooont58021111iy†223223223223nnnn12s0000s....T123l............2222essss..S00113556052052052052hd(20...5555t6525802m((((iiy5±±±±±±±±±±±±±mmmmsmLLLL0000±±±Ll±±±±0±em3556000dmmmm000000000000e0.00001...1)i............n12.2223m....334334334334))))15.2222&s2...&&&&052ie5oW1n±±±nL2230000WWWW±.111111111s2....1.11.1e1000052di6..6..6..6..00.10eeee5o22222222....i2....36363636eg.342...iiii±±±55555555nL26856gggg±th5WWWWW±±±±±±±±e3±±±hhhh±±±±±±±±000t±d0r000±tttt0...00000000m0(e11.33400000000....m.12........((((1112.t6..1..21..21..21..22igggg22.e22222222n536g555555))))re)W0m±±11s±±1.6..00i22.t00n63h..55TTTT1..2Tee22W0±±50000000000000000s±±0mmmmm.n................5.00t5677567756775677aaaa567700uah5..xxxx1..2xme22....T5b0000nme....u5677armx0000To0000.....00b3333....f00000m4444..e....c33.±±±±56774aAAAA±±±±ro±±NNNNNNNNWWWWxA±00000n00o0.0000WNNoooooooo0.....rrrrd..3.f1111....ttttttttaaaa411.oo2222u2r5555ppppc±aaaaaaaa55attA±covvvvvvvvNNWptaaaaaa00aaaaaaaano0oo0vvrrrr.riiiiiiii.aoooo1.lllllllldrttaaa3.aaaaaaaa2r4suuuu5piiaau00001111bbbbbbbboll±nnnnvvwaa........A±cllllllllua99997777eeeeeeeeaaNN010ddddbbBBBBtr0nhiimmmmmmmmoo0...oollll††††.aa679deeiu1.rttcB01iiiiiiiibb2nnnnnnnnsn5hmmm..aall197eedBvvwmmiiimaa†nnnhiiiillannaai00000000yc01bb00000000........h..ll....44444444....pPPPP97ee33332222Ballllmmmaaaa±±±±±±±±0000†00CCCC±±±±±±±±s0nnnn00....iis..a00000000nn2344..44.aaaaP00000000332yu........0±±±rrrrl....11111111....C±a±±11111111n000C±±±p55555555n0d0...00aa111.001.e..r00s.11551.50011rs..55.44.t32uh0000000000000000±±nC±±e................WWWW0000000000000000d0000s0000222211110000e..tttt0000u.11.999900005555555512486W11r....Wr550000.....ft527550210atth9055cee  Wt                                                T                                                                                                                                                                                                                                                                                 C

                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   A

                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               sm0000u....or0000fu0210an9055cteedmdoeuvnictee.d device. AsrAsrAsrAsreeeeuuuuAAAAllllssssttttrrrrWWWWiiiieeeeffffssssaaaarrrrttttAsrrrrrnnnnaaaacccceoooouAlppppeeeesaaaatrrrrrLLLL----WiessssfBBBBaaaattttsammmmriiiirrrrtrvvvvoooonaco((((eeeeuuuupooooe3333arLnnnn-sBuuuuatffffssssddddmaaaairnnnnttttvoccccttttAAAAyyyy(eueeeeeeeotttt3llllssssrrrrniiiieeeeummmmfnnnn))))sdaAsrssssntggggciiiietAuynnnneetlffffslaaaastrrieoooomnWi)ettttfsiiiisWWWWaoooorrrrgritrnnnnnnacofasssspoeatrLi-WsoratmnirvosTTTT(euo3nufsdantctAyeetlsriPPPPemn)llllLLLLaaaasginnnnnPfaaaaaloLarrrrtinWortttteeeeanrrrrCCCCrsmmmmteiiiirnnnnCmaaaattttiniiiiooooannnntissssoWWWWnsPWlLanCCCCarTTTTCteTrminationsWBT                                                                                                                                                                                                                                                                                                                                                            C

                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 T

        ††††TTTThhhhiiiissss  ddddiiiimmmmCoeeeennnnCTnhssssosiiiieooootnrnnnnruseddddtscieeeertsutttttieeeeoocrrrrrnmmmmtmioiiiinnnnaneeeetessss rttttihhhhaleeeeisnnnnuuuuscmmmmrebbbbeeeeenrrrr  ooooffff ccccoooonnnndddduuuuccccttttoooorrrrssss  wwww96hhhh%iiiicccchhhhammmmluaaaamyyyy ippppnaaaaassssssssTeuuuurnnnnmddddeeeeiTPrrrrnlettttaahhhhrnteeeemaiorssssiuuuun(norrrrsffffaraaaatscccciieeeenogmmmmnlesoooo-uuuusinnnndtttteeeeeddddd)                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           ddddeeeevvvviiiicccceeee....

                                                                                                                                                                                                    printed onto a                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 termination                         is  gold  and                                                                                                                                                                                                                                                                               suitable                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              for
        iiiiCTfMAoCTfMAoCTfMAoCTfMAossssnnnnoooouuuuhhhhrrrrlllloooossssllllllllbbbbeeeeaaaalllluuuurrrroooorrrrnnnnsssseeeelllleeeerrrrrrrrwwwwttttaaaaeeeesssseeeekkkkrrrrlllltttteeeellllaaaatttteeeessss....eeeeiiiivvvvttttiiiirrrrddddnnnniTfMAosddddssssGeeeeaaaanouuuuuhttttrlggggnnnnesoooobbbbllbddddaaaaealccccurnttttoifMAosrrrrryyyyGsennnneeeettttoleruerwtariiiielvvvvmmmmiiiiddddeeskrnnnnlaaaarllbteoooolalaiiiiuraesn.nnnnoeccccffffirsveaaaatcccciloooodnlernnnneeeeedswteaaettttooooNtooookrlrrrrr....eeeegnteolbammmmvvvvdaea.rrrroeirrrrtvryeeeetgggglnedniiiidteaaaaaaaaairrrrevaaaamNdnaeeeegnltltltltbinnnndaniiiicfoddddaiiiitoooocyosssseiiiinettcccconnnnoir.evewwwwdnassssmvriccccrccccncfeiiiigiiiiioooocssssrrrroaatttteraeeeeohhhheaaaaoltr.rrrrneeeeimvdeeeettttiorsaaaaiiiiinnnnegcccccnnnnnawroooosappppggggcepppptcirrrrniiorrrrs....rdtrrrrddddoooooeihiiiaTTTTcrnnnneeeenettttwethhhheeeeddddattttinccneeeeiiiiicccciososssstpgooooddddptttthariiiirr.ccccnnnnrdoooooetooooiooooTaneinnnnctnttttnnnnnnnhedtohhhhpgettttccccicssssrseeeeoooorodtttt.ooootdorrrricnommmmTppppuuuueaaaaotohnedrrrrcccctnppppn9999iiiihicttttmmmmtscsrrrriiiio6666teoooooiiiitoisssscaaaanr%%%%onnnnmiiiipuaorrrrnnnnnyyyyrtcnggggpgggg9ihtaaaamcsppppriiiii6evvvvollllitooooouuuusaaaaa%reeeenimffffpummmmccccrnssssykkkkrcaaaaggpiiiiiaaaaaaaaatmpnnnnirivlggggnnnnoggggouaiaaaaesallllfeeeemcnaaaasirnkazzzzyiagagneeeegngpiavoleaaefczsekaaaaaTPwSWrTPwSWrTPwSWrTPwSWraaeeeettttlllleeeegnoooogaaaaiiiissssrrrrrrrrl2222rrrriiiiennnnaaaaaeeeellllssssmmmmdddd6666ppppaaaaaPwSWrztttt----eaaaabbbb0000etlrrrr----eeeeoaisnnnnaaaaiiiiroooor°°°°2((((inannnnerrrrlsrrrrooooccccCCCCnnnnd6pooooaaaaat-eeeeaaaarrrrddddab0r-uuuuebbbbffffnattttoiiiissss°ppppawSWroooo(nnnnnnnnrriiiiiiiieocCiiiinnnnntrrrrrrrroaooooddddogggglllleisoooordrriiiiggggu23333i;;;;bfaettttnnnnlppppsisttttpollllnnd60000pyyyywwwwt-ieeeeeeeeieeeenrssssrabdgl0-rrrr----oerrrrigrrrrssssnammmmssss3;otttt°tpaaaateeeeriiiiliiiircC0ywnddddeeeeeeeppppoiiiiaccccennnnr-dsssseeeeroooorusmsbft....aaaaaaaaaddddiepiinnnnonnderrrrttttpTTTTii))))crddddrooooniiiidglsehhhhoooootttti.aassssuuuud3;eeeetneeeennnpt....rtTnnnn)0ywrrrreyyyydoissssehommmmddddtrsurrewwwwesoooonm.taniiiieryiiiiisnnnnnnnnessssmiiiipdicllllnaaaawllllsoossssHHHHi.ttttaaiwwwwnnuuuusniiiiiRRRRlrtTooooaliiiidoiiiiisHtttthottttnnnntwaaaaurrrrsuhhhhiReneeeeo.bbbbiniiiiisssstysssstnsssssllllattttrhdiiiieeeeeaaaassssbwoggggisttttssnnnnlffffitnooooooooiesiooooasddddlgllllrrrrltnddddrrrrsHfssssoowoiiiiudmmmmsssslrRhhhhaaaadrisooooitinnnntaaaammmmmsallllrhhaddddvvvvoddddebnaseeeemeeeeeeeeslldtvdssssrrrrierrrrasessssegggguuuueiiiitnnnnniiiisrfrooooiiiiooooosguttttioggggdniooooaaaannnnroior....stgbbbbddddioanmiiiis.llllhnnnnbdoeeee‘‘‘‘iallllmlnleeeeessss‘dffffvlooooaaaaooooeeseefcccclllloarrrrorrddddhhhhsgiclrndeeeeih’’’’oorrrreg’onr.din‘lesoacldhe’r

                              WelwWynelwCoynmpCoonmenptosnrensetsrvreesstehrveersigthhtetorigmhatkteocmhaankgeecshinanpgroesduinctpsrpoedcuifcictastpioenciwficitahtoiount nwoitihcoeuotr nlioabtiicliety.or liability.

                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 A subsidiary oAf subsidiary of
        BI Technologies IRC Welwyn GTAGWGWGWGWAAAATllllleeeeelllleeeeiEnniiiillllnnnnnnnnwwwwlfeeoffffeeeecyyyyoooorrtnnnnmrrrrarrrrrommmmaaaaCCCCalnllllaaaatNoooo©TAiictttteoNNNNmmmmlsiiiiolloooonerWiooooppppnnnntpeni©TAsooooeshftttteiiiioeesnnnnlssseeeeollurereeeelnWvssssimbwpnnnnneuuuuejhfastttte:bbbboessssytoc+tjjjjireeeehtolnnrrrrm4weeeeccccetne4ttttossssa:Creeeeiyttttit(sT+grrrroooo0oiovvvvTnsh4)eeeemunWWWWt4E1ssssbCtl6ieeeepoj(stttte70ochhhhllllowwwwcmst0)eeeetmurnoyyyy1a8btrrrrnnnno6keiiii2pjgggge’’’’ei7ssss2cnWhhhhocs0c1ooootttttt’hen8wwwws8otttttal1owooooew2nnnnnL·2gynnWmmmmiddddnFe1mtdaaaaa’aaase8ssacttttkkkklii1aaaawonstteeeeLaiwem·yaaaapiccccandnnnnFrmihhhholna’ddddesaaaadddc·:innnnaousiiiitB+ssssiggggtiscwemea4tcccceeeecddn4oooossssiaollpiennnnnn(iiiid·nnnne0:dssssgaciiiiB)+ddddttppppiio1efsa4eeeeirrrrdcn6oooor4rrrcaaeeee,l7oddddintdnddd(0Nnuuuui0dogsaoccccaaaa)8nitcttttrdicccc2o1stcweccccssssh9n6ucuuuupppprui4,7erotrrrreeeeamh6d0Naaaanccccto5ttttebsiiiioaeeee8ffffuieiiiic·rdat2cccctrcaaaatEeaaaahln9uattttmrtttttuo4reniiiiittttmaooootma6diiiidimmmmtnnnnic5eelb:eNaeeeewwwwoeac·iEonrfctoooo2Eiiiirlfttttuagtffffom2hhhhliirnom@aggggooooaa7diboooontuuuuweiAeligiiiitttt:NlnnnnAeiotainnnntElggggyfn,wotoooo2.fgUttttytoptttt2oooooiKiiiinm@rccccii7-neeeenpppptweAgttrrrroooo..iiiicAeonnnntrrrroloftttt,wllllm....iiiigUpaaaayobbbbrKn·iiniiii-nWlllltiiiitttttgt.yyyye.....cbtoosmitper:·inwWtw.ewbs.witee:lwwywn-wtt.wcoemlwyn-tt.com
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           TT electronicsTTplcelectronics plc

        ©©©©©TTTTeeeelllleeee2TWWWWpppp0ThhhheeeeooooE2llllnnnnl0wwwweeeeec::::yyyyt++++rnnnno44444444nCCCCi((((c0000oooos))))mmmmp11116666lppppc7777oooo0000nnnn8888eeee22222222nnnn1111tttt8888ssss1111LLLL····iiiiFFFFmmmmaaaacccciiiissssttttiiiieeeemmmmddddiiiilllleeee····:::: BBBB++++eeee4444dddd4444lllliiiinnnn((((0000gggg))))ttttoooo1111nnnn6666,,,,77770000NNNNoooo8888rrrr2222tttthhhh9999uuuu4444mmmm66665555bbbbeeee···· rrrrEEEEllllaaaammmmnnnnaaaaddddiiiillll::::NNNNiiiiEEEEnnnn2222ffffoooo2222@@@@7777wwwwAAAAAAAAeeeellll,,,,wwwwUUUUyyyyKKKKnnnn----tttttttt....ccccoooommmm ···· WWWWeeeebbbbssssiiiitttteeee:::: wwwwwwwwwwww....wwwweeeellllwwwwyyyynnnn----tttttttt....ccccoooommmm                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               www.ttelectrTTTToTTTTnAAAAieeeecllllsIsssseeees.uuuucsccccoubbbbttttrrrrmessssooooiiiidddd/nnnnBriiiiiiiieaaaacccc·srrrrssss0iyyyys3pppptooooo.llllcccc0ffffrIs2ssue B · 03.02

                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           IIIIssssssssuuuueeee BBBB ···· 00003333....00002222
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   02.18
222000
HHigigh hVaVluaeluSuerfaScuerface

MMoouuntnetdeRdesRisteosrsistors

HHRRSSereireises                                                                                                                                                                                         Welwyn Components

Performance Data

                                                                                                                                                                         Maximum                         Maximum    Typical     Typical

LoLaodad(1a0t00rahtersd@p7o0w°eCr): 1000 hours at 70°C                                                                            ∆R%                                     ±2ΔR%                          2                   1  1

ShOovretrtleoramd overload ( 6.25x Pr or 2.5x LEV for 5s)                                                                         ∆R%                                     ±1ΔR%                          1          0.2         0.2

Shelf life (12 months)                                                                                                                                                    ±ΔR%                           2                      1
Shelf life: 12 months at room temperature                                                                                         ∆R%                                     2                                                  1
Temperature cycle (5 cycles, -55/+155°C)                                                                                                                                  ±ΔR%                           1                      0.3
Temperature rapid change                                                                                                          ∆R%                                     1                                         0.3
Resistance to solder heat (260±5°C for 10±1s)                                                                                                                             ±ΔR%                           1                      0.5
Change on Wave Soldering                                                                                                          ∆R%                                     1                                         0.5
Voltage proof                                                                                                                                                             volts                          0503:100 0603: 300 0805 to 1206:500

VoVlotaltgaegecoperfofiocifent of resistance (10V to 25V)                                                                         volts                                   0%5/0V3 :  100                 0805 to 1206 : 500

Voltage coefficient of resistance (10V - 25V)                                                                                     %/V                                     0603                           2                      0.7

                                                                                                                                  0805                                    01805                          1          0.4         0.4

                                                                                                                                  1005                                    01.8005                        0.8        0.3         0.3

                                                                                                                                  1206                                    01.2206                        0.2        0.05        0.05

Application Notes

Mounting                                                                                                                                                       Packaging

This chip resistor is ideally suited for handling by automatic                                                                                                 Resistor chips are supplied taped and reeled on standard

methods due to its rectangular shape and the small                                                                                                             8mm tape to IEC 286-3.

dimensional tolerances. Electrical connection to a ceramic                                                                                                     Quantity per reel 3000 max.

substrate or to a printed circuit board can be made by wire

bonding to planar terminations or by reflow soldering of                                                                                                       Planar Terminations

wrap-around terminations. The ‘F’ terminations provide good                                                                                                    Resistor chips are supplied in waffle packs.

leach properties and ensure reliable contact. Due to the

robust construction the resistor chip can be immersed in the

solder bath for 30 seconds at 260°C. This enables the resistor

to be mounted on one side of a printed circuit and wire-

leaded components on the other side. The resistor must be

kept dry during use to avoid leakage. The presence of

moisture will not damage the resistor in any way.

OOrrddeerrininggPProrcoecdeudreure

Example: HR1206 with solderable wraparound terminations at 10 gigohms and 50% tolerance

Eoxnama prelee:l HofRu1p20to6F3-01000GYpiIe(c1e2s06- with solderable wraparound terminations, 10 gigohms ±50%, Pb-free)

                                                                                                                                                               HR1206F– 10GYI

Type       H          R      1  2         0  6             F  -  1                                                          0  G                            Y  I

Size              1                    2                   3                                                                4                               5     6

Ter1minat2ion                   3                                4                                                                                          5                        6

FTypSeolSdeizreable wraTpearrmouinnadtion0805, 1206 oVnallyue                                                                  Tolerance                                 Termination & Packing
GVaHluRGe o(000lud568s000pe335aIdEFpCla600n1268a200r0c356o,,dewS)roalpdaerrAoaulbl nlsedizesM3/E4=2c4mhoaerrgaEoch9tem6rss
                                                                                                                                  J = ±5%                               Pb-free solderable (RoHS)

                                                                                                                               K = ±10%                              I    0603F                          5000/reel

                                                                                                                               5 = ±25%                                  0805F,1206F                     3000/reel

TJ ole5ra%n11c02e0056(uGse5  IEACll62 cGodoeld) pad           G = gigohms                                                      Y = ±50%                                   SnPb solderable

                             size2s5%     planar                                                                                                                     PB   0603F                          5000/reel

K     10%             Y         50%                                                                                                                                      0805F,1206F                     3000/reel

                                                                                                                                                                          Gold pad planar

Packing                                                                                                                                                              I    xxxxG                          Waffle

   I  Tape                   0805F, 1206F                        Up to 3000/reel                                                                               Standard

      Waffle                 G Termination

General Note                                                                                                                                                                         BI Technologies                IRC         Welwyn

T©T EWlecetrlownicysnresCeorvems tphoe nrigehnt ttosmLaikme citheandgeBseindlpinrogdtounct, sNpoerctifhicuamtibonerwlainthdoNutEn2o2ti7ceAoAr,liUaKbility.

ATelllienpfohromnaet:io+n4i4s s(0ub) j1e6ct7t0o8T2T2E1le8c1tr·onFaiccss’imowilne:d+a4ta4a(n0d) 1is6c7o0ns8id2e9r4ed65ac·cEumraateil:aitntfiom@ewofeglwoyinng-ttto.cpormint·. Website: www.welwyn-tt.com                         Issue B · 03.02

                                                                                                                                                                                                                    www.ttelectronics.com/resistors

                                                                                                                                                                                                                                                     21

© TT Electronics plc

                                                                                                                                                                                                                                              02.18
Mouser Electronics

Authorized Distributor

Click to View Pricing, Inventory, Delivery & Lifecycle Information:

TT Electronics:

HR0805F200MKT    HR1206F100MKT  HR0805F1GJT     HR0805F-1G55I   HR1206F-1G0JI   HR0805F-10G5I

HR1206F-560MJI  HR1206F-510MJI  HR0805F-300MJI  HR1206F-110MJI  HR1206F-300MJI  HR1206F-150MJI

HR1206F-100MJI  HR0805F-110MJI  HR0805F-750MJI  HR1206F-330MJI  HR0805F-330MJI  HR0805F-820MJI

HR0805F-100MJI  HR1206F-680MJI  HR0805F-470MJI  HR0805F-680MJI  HR1206F-470MJI  HR1206F-200MJI

HR0805F-910MJI  HR1206F-750MJI  HR0805F-560MJI  HR1206F-820MJI  HR0805F-510MJI  HR1206F-620MJI

HR0805F-620MJI  HR1206F-910MJI  HR0805F-150MJI  HR0805F-1G0JI   HR0805F-200MJI  HR0603F-100MJI

HR0603F-150MJI  HR0603F-62MJI   HR0603F-47MJI   HR0603F-200MJI  HR0603F-300MJI  HR0603F-20MJI

HR0603F-750MJI  HR0603F-82MJI   HR0603F-330MJI  HR0603F-68MJI   HR0603F-910MJI  HR0603F-51MJI

HR0603F-560MJI  HR0603F-15MJI   HR0603F-620MJI  HR0603F-30MJI   HR0603F-75MJI   HR0603F-820MJI

HR0603F-56MJI   HR0603F-470MJI  HR0603F-510MJI  HR0603F-1G0JI   HR0603F-33MJI   HR0603F-680MJI

HR0603F-91MJI   HR0603F-10MJI

小广播

About Us 关于我们 客户服务 联系方式 器件索引 网站地图 最新更新 手机版

站点相关: 大学堂 TI培训 Datasheet 电子工程

北京市海淀区知春路23号集成电路设计园量子银座1305 电话:(010)82350740 邮编:100191

电子工程世界版权所有 京ICP证060456号 京ICP备10001474号 电信业务审批[2006]字第258号函 京公海网安备110108001534 Copyright © 2005-2017 EEWORLD.com.cn, Inc. All rights reserved