电子工程世界电子工程世界电子工程世界

产品描述

搜索
 

BMI-S-203-F254

器件型号:BMI-S-203-F254
器件类别:热门应用    无线/射频/通信   
文件大小:106554.59KB,共117页
厂商名称:LSR
标准:  
下载文档

器件描述

bls 2psh frm snsat tnr

参数
Datasheets:
EMI Catalog:
Standard Package : 1,800
Category: RF/IF and RFID
Family: RF Shields
Series: -
Packaging : Tape & Reel (TR)
Type: Frame
Height - Overall: 0.200" (5.08mm)
Length - Overall: 1.032" (26.21mm)
Width - Overall: 1.032" (26.21mm)
Ventilation: -
Mounting Type: Solder

BMI-S-203-F254器件文档内容

EMI

      CATALOG

               www.lairdtech.com
ABOUT LAIRD TECHNOLOGIES

Laird Technologies designs and manufactures customized, performance-critical
products for wireless and other advanced electronics applications.

The company is a global market leader in the design and supply of electromagnetic
interference (EMI) shielding, thermal management products, specialty metals,
signal integrity components, and wireless antennae solutions, as well as radio
frequency (RF) modules and systems.

Laird Technologies is the world leader in the design and manufacture of customized,
performance-critical products for wireless and other advanced electronics
applications. Laird Technologies partners with its customers to customize product
solutions for applications in many industries including:

Network Equipment                        Aerospace
Handsets                                 Defense
Telecommunications                      Medical Equipment
Data Transfer & Information Technology   Consumer Electronics
Computers                               Industrial
Automotive Electronics

Laird Technologies offers its customers unique product solutions, dedication to
research and development, as well as a seamless network of manufacturing
and customer support facilities across the globe.
TABLE OF CONTENTS

EMI INTRODUCTION                               2  Fiber Optic Shield                        40

EMI SUMMARY                                    3  GBIC Fiber Optic Shield                   40

BOARD LEVEL SHIELDS                            6  "D" Connector Shielding / Slotted "D"     41
                                               6
Product Selection Guide                        8  Precision Stamped Metals                  42
Introduction                                   9
Standard Design Shields                       11  Contacts                                  42
EZ PeelTM                                     11
Rigid Corner                                  12  Custom Design                             44
ReCovrTM                                      12
ReMovl                                        13  Metals Galvanic Compatibility Chart       46
Overview
                                              14  VENT PANELS                               48
FINGERSTOCK                                   14
                                              15  MaxAirTM                                  49
Product Selection Guide                       16
Introduction                                  17  Elecro-AirTM                              50
Mounting Methods                              18
Ordering Information                          18  ElectroventTM                             51
UltraSoft Series                             19
Recyclable Clean Copper                       21  FABRIC-OVER FOAM                          52
Slot Mount Series                             21
Dual Slot Series                              22  Product Selection Guide                   52
Teardrop Series                               22
Compact PCI Symmetrical Mount                 23  Introduction                              54
Alternate Slot Series                         24
Variable Slot Mount                           25  EcoGreenTM                                56
Symmetrical (S3) Slotted Shielding            26
Solid Top (S3) Symmetrical Slotted Shielding  27  I/O / Gasket Selection Guide              57
Clip-On Symmetrical Shielding                 28
No Snag Gasket                                29  Profile Selection Guide                   58
All-Purpose Series                            31
Clip-On Series                                31  I/O Selection Guide                       62
Low Profile Hook-On Gasket                    32
Low Profile Gasket                            32  Knitted Conductive Gaskets                65
Large Enclosure Series                        33
Double-Sided Contact Series                   33  Visual Part Reference Guide               66
Foldover Series                               34
Stainless Steel I/O Shielding                 34  Part Number Cross Reference               67
Flexible Low Compression Series               35
Clip-On Twist Series                          35  Ultraflex                                68
Twist Series                                  36
Divider Edge Shielding                        36  All Mesh                                  69
Card Guide Clip-On                            37
Clip-On Perpendicular Shielding               37  Elastomer Core                            70
Clip-On Perpendicular Grounding Strip         38
Clip-On Longitudinal Grounding Strip          38  Electroground EMI Washers                72
Mini-Longitudinal Grounding Gasket            39
Longitudinal Grounding Series                 39  Electromesh Tape                         75
Custom Stamping                               39
Contact Strips / Contact Rings                39  Conductive Fabric                         76
IEEE 1394 Horizontal Connector Gasket         40
DIN Connector Series                              MRI "A" Fabric                            77
USB Connector
                                                  Conductive Tape                           78

                                                  ELECTRICALLY CONDUCTIVE ELASTOMERS 79

                                                  Introduction                              79

                                                  Product Selection Guide                   80

                                                  Case Study                                81

                                                  Visual Part Reference Guide               85

                                                  ElectrosealTM Conductive Elastomer        86

                                                  Extrusions Guide                          87

                                                  GeminiTM Coextrusions                     93

                                                  Fabricated Components Guide               95

                                                  Metal Impregnated Materials               99

                                                  Specialty Products                        102

                                                  Automated Form-In-Place Gaskets           103

                                                  MICROWAVE ABSORBERS                       105

                                                  Product Selection Guide                   105

                                                  Design Guide                              106

                                                  Q-Zorb 2000 HF                           109

                                                  Q-Zorb 3000 HP                           110

                                                  RFRET 4000                                111

                                                  RFLS 5000                                 112

                                                  Analysis, Test and Prototype Development  113

www.lairdtech.com
   EMI ESSENTIALS

   EMI INTRODUCTION

   Overview of EMC/RFI Issues
   The phenomenon of electromagnetic interference (EMI) is familiar to virtually everyone, even if they do not
   understand the underlying principles. Most people have witnessed firsthand the effects of interference.
   To control EMI, government organizations, such as the FCC, CSA, and EEC, mandate that manufacturers may
   not design, produce or sell electronic equipment that jams the public broadcast services. In other instances,
   however, EMI can constitute more than a mere nuisance. The military and medical communities, for example,
   require trouble-free operation of their electronic equipment in adverse electromagnetic environments since
   malfunctions could jeopardize missions and personnel. The European Union's EMC directive also mandates
   that "the apparatus has an adequate level of intrinsic immunity to electromagnetic disturbance to enable it

   to operate as intended".

   EMC Design of High Speed Systems
   The interference and susceptibility (immunity) effects of electronic apparatus are created by time-variant
   electromagnetic fields which may be propagated along a conducting medium or by radiation through space.
   Because the source of the conducted and radiated interference energy levels may be related, a coordinated
   systems design effort is required to reduce these effects.

   A design program for an equipment item that must meet both an emission and an immunity requirement
   consists of:

       Suppression: Reducing the interference at its source.
       Isolation: Isolating the offending circuits by filtering, grounding and shielding.
       Desensitization: Increasing the immunity of any susceptible circuits.

   These three steps should be carried on throughout the entire equipment design and implemented as early
   as possible within the design program.

   Effects of Logic Speed
   The trend in today's electronic devices is faster, smaller, and digital rather than analog. Most equipment
   (95%) of today contains digital circuits. Today's digital designer must create a circuit board that has the
   lowest possible EMI, combined with the highest possible operating/processing speeds. Design of the PCB
   is the most critical EMC influencing factor for any system, since virtually all active devices are located on
   the board. It is the changing current (accelerated electron movement) produced by the active devices that

   result in EMI.

   Design Approaches
   There are two approaches that can be used to reduce the emission from the PC board. The first approach is
   to operate the circuit at the slowest speeds consistent with the functionality of the system, lay out the PCB
   with the smallest possible loop areas (especially the high speed devices), and insert suppression components
   such as filters, ferrite beads, and bypass capacitors into the circuit to reduce its bandwidth. These techniques
   will result in a desired decrease in the high frequency harmonic amplitudes and circuit bandwidth and a
   corresponding undesired decrease in both the operating speed and system reliability. The use of slower
   speeds with reduced bandwidth will help to desensitize the circuit to external susceptibility fields.

   The second is to use shielding. Shielding is the only non-invasive suppression technique. Since the shielding
   is not inserted into the circuit, it does not effect the high frequency operating speed of the system, nor does
   it effect the operation of the system should changes be made to the design in the future. In addition,
   shielding does not create timing problems and waveform distortion; it does not decrease system reliability;
   and it reduces crosstalk. Plus, shielding works for both emission suppression as well as susceptibility
   (immunity) problems.

2  Even with the overall advantages of shielding, the most cost-effective approach is to use a combination

   of circuit suppression/hardening and shielding.

   www.lairdtech.com
Applications                   Fabric-Over-Foam and Conductive Foam                            Wire Mesh                                            Tape

                               Shielding or grounding of computer and          Covers opened infrequently for servicing       Design flexibility provides grounding and
                                telecommunication equipment seams                (6-12 times per year)                            shielding solutions for I/O shielding panels,
                                and apertures                                                                                     disk drive insulators, ground planes or circuit
                                                                               Long lasting resiliency is ideal for highly      boards, electromedical devices, keyboard
                                                                                 sensitive components in permanent or             devices
                                                                                 semi-permanent enclosures
                                                                                                                                 Mask-and-peel tape for painted electronic
                                                                               Consistent point-to-point contact for high       enclosures
                                                                                 shielding effectiveness over the life of the
                                                                                 gasket                                          Cable and wire harness wrapping

Features and Benefits          UL 94VO and HB flame retardant                  Most economical gasket for low-cycling          Simple installation
Product Highlights             Ideal for applications requiring low             applications                                    Ideally suited for thin or low-profile

Electrical Shielding            pressure force                                  High shielding effectiveness over broad          applications
Effectiveness                  Self-terminating cut-to lengths                  frequency range                                 Conductive foil tape with release mask for
Transfer Impedance (500 MHz)   High conductivity and shielding attenuation
H-field (200 MHz)             Galvanically-compatible with most mating       Available in wide variety of sizes and shapes    painted enclosures
Modified Mil 285                                                                Knit construction for long lasting resiliency   Tin copper cloth and nickel copper cloth
Plane Wave (2 GHz)              surfaces                                        Versatile mounting options
Modified Mil 285               High abrasion and shear resistance             Available with elastomer gasket for moisture     versions provide easy-to-handle alternatives
Surface Resistivity                                                                                                               to foils
Volume Resistivity            >85 dB                                             and dust sealing
Mechanical
Available Size Range                                                           90 - 105 dB                                      --

                              30 - 45 dB                                       55 - 65 dB                                       --

                              90 - 100 dB                                      80 - 115 dB                                      85 - 95 dB

                              <0.07 ohms/square                                N/A                                              Low surface resistivity based on material selection
                              N/A                                              0.0004 - 0.114 ohm-cm                            N/A
                              Height: 0.015 - 0.945 (0,038 - 24,0)             Height: 0.062 - 0.500 (1,57 - 12,7)              Width: 0.025 - 2.00 (6,4 - 50,8)
                                                                                                                                Thickness: 0.003 - 0.007 (0,08 - 0,18)

Deflection Operating Range    20 - 75% deflection                              20 - 70% deflection                              N/A

Compression Force             3 - 10 Ibs/in. ft. (4,5 - 15,0 Kg/m)             From 6 - 50 Ibs/in. ft.                          N/A
(based on shape selection)    @ 20% deflection (dependent on foam              (8,8 - 74 Kg/m) round
                              selection and shape)                                                                              N/A
Compression Set                                                                                                                 N/A
Joint Unevenness              <4 - 20% @ 50% deflection                        10% @ 20% compression                            Tin-plated copper, copper foil, nickel copper
Accommodation                 0.020 - 0.050 (0,51 - 1,27)                      0.010 - 0.300 (0,25 - 7,6)                       cloth tape
Compound/Material
Availability                  Cover: Flame retardant metallized Ni/Cu,         BeCu, Monel, aluminum, tin-plated steel,

                                    Tin/Cu and silver woven or non-woven textile. tin-plated brass, Enviroseal version with

                              Core: Flame retardant urethane, TPE              neoprene or silicone

Temperature Range             -40 - 158F (-40 - 70C)                         Enviroseal -103 - 500F (-75 - 260C)            50 - 500F (10 - 260C) based on material
Available Profiles                                                                                                              selection
                              Round, rectangular, square "D", "C", "J", "P", Round, rectangular, square, single-round with
Mounting Methods                                                                                                                Rolls
Custom Shapes Available
                              "U", clip-on, knife edge                         fin, double-round with fin
Environmental
Fluid Seal                    Groove, PSA, clip-on, dart                       Groove, pressure-sensitive adhesive,             Pressure-sensitive adhesive, conductive or
Air/Dust                                                                       mechanical fasteners, channel mount              non-conductive
Galvanic Compatibility        Cut-to lengths, mitered and spliced corners,
                              kiss-cut, other profiles                         Cut-to lengths, mitered corners, flat tape, and  Die-cut shapes
                                                                               EMI washers

                              N/A                                              Enviroseal product only: moisture, rain          N/A

                              Provides barrier against dust                    Enviroseal product only                          N/A

                              Compatible with a wide variety of mating         Variety of platings to ensure galvanic           Wide variety of materials available to meet
                              surfaces--zinc, aluminum, stainless steel, etc.  compatibility with mating surface                galvanic compatibility requirements 3

wwwwww..llaaiirrddtteecchh..ccoomm
Applications                                    Fingerstock                                    Board-Level Shields                                                 Vent Panels and Filters

                               Ideal for high-cycling applications requiring       All applications that require shielding of       Provides air flow for component cooling and a barrier to
                                frequent access                                      board- level components                           reduce RF leakage

                               Ideal in wiping applications when gasket needs      Low height down to 0.04 (1,0)                   Sizes range from small muffin fans on desktops to large
                                to be engaged from either the top or side            accommodating mother/daughter board               room-size facilities
                                                                                     configurations
                               Wide variety of profiles and mounting methods                                                         Available in commercial and military grade materials
                                accommodating applications from small hand-         Secure cover design ideal for applications
                                held devices to room-size enclosures                 subject to shock and vibration such as
                                                                                     mobile military vehicles, commercial aircraft,
                                                                                     and wireless electronics

Features and Benefits          Large selection of sizes and shapes                Custom shapes available                         Available in a wide range of materials and platings
Product Highlights             Wide mechanical operating range                     Provides isolation of board-level                 that meet a broad range of shielding effectiveness
                               Superior performance at elevated temperatures                                                          requirements
                               High shielding effectiveness levels                  components
                               Ideal for high-cycle applications                   Minimizes crosstalk and susceptibility          Varied mounting configurations meeting
                               Good design flexibility with either wiping action                                                      environmental space criteria
                                                                                     without impacting system speed
                                or in compression                                  Available in tape-and-reel for automated         Available protective grille for high traffic areas
                               For use in a wide variety of slotted and                                                             Provides cooling of electronic equipment while
                                                                                     pick-and-place applications
                                grounding contact applications                      ReCovr/ReMovl features available for              maintaining EMI integrity of enclosure
                                                                                                                                     MaxAir vent panels offer 10-20% additional airflow
                                                                                     convenient component access.
                                                                                                                                       over frames Al vent panels
Electrical Shielding          80 - 100 dB                                          --
                                                                                                                                     --

Effectiveness

Transfer Impedance (500 MHz)

H-field (200 MHz)             60 - 70 dB                                           48 dB                                             40 - 70 dB
Modified Mil 285

Plane Wave (2 GHz)            75 - 120 dB                                          40 - 60 dB                                        45 - 115 dB
Modified Mil 285              N/A                                                  N/A                                               N/A

Surface Resistivity

Volume Resistivity            N/A                                                  N/A                                               N/A

Mechanical                    Selection of various sizes and configurations        Fence and lid: 0.130 - 1.00 (3,3 - 25,4) height Thickness: 0.25 - 0.500 (6,35 - 12,7)
Available Size Range          to accommodate gaps from 0.010 - 0.400               6.000 (152,4) width
                              (0,25 - 10,2)                                        One-piece construction: 0.04 - 0.25 (1,0 - 6,4)
                                                                                   height, 0.250 - 0.375 (6,35 - 9,53) width

Deflection Operating Range 20 - 80% deflection,                                    N/A                                               N/A

                              Maximum deflection is dependent on the part

                              profile

Compression Force             UltraSoft 98 Series: 1.6 Ibs/in. ft.                N/A                                               N/A

(based on shape selection) (2,4 Kg/m) to 41 Ibs/in. ft. (61 Kg/m)

                              Standard 97 Series: 3.1 Ibs/in. ft.

                              (4.6 Kg/m) to 118 Ibs/in. ft. (176 Kg/m)

Compression Set               None within operating range                          N/A                                               N/A

Joint Unevenness              0.003 - 0.350 (0,08 - 8,89) maximum                  N/A                                               N/A

Accommodation

Compound/Material             Standard material is Beryllium Copper, other         Tin-plated phosphor bronze, tin-coated steel,     Gasket material: Monel, tin/copper/steel, BeCu,
Availability                  beryllium free variants on request                   stainless steel, brass, BeCu, and nickel silver;  metallized fabric-over-foam
                                                                                   other materials also available                    Fingerstock frame: aluminum alloy, steel, brass
                                                                                                                                     Honeycomb material: aluminum, steel, brass,
                                                                                                                                     metallized polymeric

Temperature Range             Continuous operation @ 250F (121C)                 Withstands reflow and solder temperature          N/A

Available Profiles            Over 350 standard shapes available, as well          Squares, rectangles, L-shapes, 90 inside         N/A
                              as cut-to lengths and modified standards that        corners, and other custom shapes
Mounting Methods              include finger removal, notches, punch holes, etc.                                                     Captive fastener thru-holes
Custom Shapes Available       Clip-on, Sticky Fingers (pressure-sensitive         Surface mount/thru-hole, various pin styles       Available in circular configurations and
                              adhesive tape), rivet, weld, solder, and slot mount  available                                         custom shapes
Environmental                 Custom designs to meet specific applications
Fluid Seal                                                                         Flexible fence with flat lid, photo etched        Drip-proof versions available
Air/Dust                      None                                                 flat blanks for hand forming, solid can
Galvanic Compatibility                                                             construction, supplied with dividers to provide
                                                                                   isolation
          4
                                                                                   N/A

                              Limited to twist series with Poron seal              N/A                                               95% open area for minimal pressure drop
                                                                                   Compatible with all solder materials
                              Over 20 plating finishes available to ensure                                                           Gasket materials compatible with wide variety of
                              galvanic compatibility with mating surface                                                             plated surfaces

                                       www.lairdtech.com
          Form-In-Place                      Electrically Conductive Elastomers                        Oriented Wire                         Microwave Absorbers

Ideal for applications with miniature   EMI and environmental sealing applications       Providing both EMI shielding and an          Antenna sidelobe reduction
  electrical housings, thin wall           where flat or groove mounting surface re-         environmental seal on cast or machined       Surface current suppression
  construction, and intricate multi-       quires a complex molded or extruded shape         surfaces                                     Applied directly to the top of high-speed
  components (i.e., cell phones, hand-
  held devices, medical instrumentation                                                    Vulcanized frame configurations can be        CPUs, LSIs, and ICs
  and equipment)                                                                             used with pre-cast housings, vent panels,    Crosstalk suppression
                                                                                             and computer terminal window frames          Improves antenna gain in RFID

                                                                                           Die-cut wall widths as low as 0.090           applications
                                                                                             (2,27) for circular military connectors      Radar cross-section reduction
                                                                                             and D-sub connectors

Automated process offers cost savings Meets military and commercial standards          Provides both EMI and moisture seal          Higher frequency use than traditional shielding
                                                                                           Available in sponge or solid silicone with   Frequency range extended used with other
on raw material, labor and assembly time Provides EMI and environmental shielding
                                                                                             Monel or aluminum wire                        shielding
Small dimension which provide critical Extruded shapes ideal for extremely narrow       Can be die-cut in complex shapes             Variety of types for custom solutions
                                                                                           Monel wire bonded into the silicone          Easy installation into noisy cavities
packaging space for board level          mounting surfaces
                                                                                             provides multiple spring effect with each     with pressure-sensitive adhesive
components                               Custom die-cut and molding available              contact point resulting in low compres-      EMI and radar cross-section reduction
                                                                                             sion set                                     Internal EMI and cavity resonance reduction,
Fast prototyping and turn over to mass Wide variety of material compounds for
                                                                                           60 - 100 dB                                     used in conjunction with board-level shielding
production                               galvanic compatibility to mounting surfaces
                                                                                                                                         N/A
Various bead size and cross section    High corrosion-resistant compounds available

shape available

Dispense on metal or plastics

85 - 120 dB                              40 - 105 dB

50 - 70 dB                               30 - 75 dB                                        25 - 60 dB                                    N/A
                                                                                                                                         N/A
70 - 100 dB                              40 - 120 dB                                       30 - 95 dB                                    N/A
N/A                                                                                                                                      N/A
0.002 - 0.03 ohm-cm                      N/A                                               N/A                                           Offered in sheets as a die-cut or kiss-cut
Height: 0.014 - 0.090 (0,36 - 2,3)                                                         0.006 ohm-cm                                  component
Width: 0.020 - 0.125 (0,5 - 3,1)         0.002 - 5 ohm-cm                                  Thickness: 0.032 - 0.250 (0,81 - 6,35)
                                                                                                                                         N/A
15 - 20% deflection                      Sheet: 0.020 (0,51) - 0.125 (3,17) thick          10 - 20% deflection
                                         O-strip: 0.040 (1,02) - 0.250 (6,35) dia.                                                       N/A
1.5 Ibs/in. ft. (0,27 Kg/cm) @           O-tubing: 0.090 (2,28) O.D. x 0.050 (1,27) I.D.   25 - 100 PSI
0.222 (0,56) height @ 20% deflection     to 0.4371 (11,10) O.D. x 0.250 (6,35) I.D.        (125 - 689 KPa)

                                         Sheet: 10% deflection
                                         Solid extrusions: 10 -25% deflection
                                         Hollow extrusions: 20 - 50% deflection

                                         Sheet: 75 - 100 PSI (516,7 - 689 kPa)

<20% @ 50% deflection                    15 - 50% @ 50% deflection                         2 - 5% @ 50 PSI (344,5 KPa)                   N/A
0.002 - 0.006 (0,05 - 0,15)                                                                0.005 - 0.015 (0,13 - 0,38)                   N/A
Elastomer silicone fillers: Ag/Al, Ag/   Sheet: 0.005 - 0.010 (0,13 - 0,25)                Elastomer: solid or sponge silicone
Cu, Ag/Ni, Ni/graphite                   Tubing: 0.005 - 0.300 (0,13 - 7,6)                Wire: Monel, aluminum                         Microwave absorbing elastomers (Q-Zorb)
                                                                                                                                         are offered in silicone; microwave absorber
-58 - 212F (-50 - 100C)                Compounds that meet MIL-G-83528:                  80 - 500F (26 - 260C)                       foam is urethene-based, open-celled foam
"D" shape bead                           Elastomers: silicone, fluorosilicone, EPDM
                                         Fillers: Ag, Ag/Cu, Ag/Al, Ag/Ni, Ag/Gl, CAR,                                                   Q-Zorb: -85 - 350F (-65 - 175C)
Directly applied to mounting surface     Ni/graphite.                                                                                    RF foam: -85 - 250F (-65 - 120C)
Infinite variety of patterns and larger  Available in NASA-specified ES75 compounds                                                      Q-Zorb thickness: 0.006 - 0.375 (0,15 - 9,53)
custom bead sizes                        for outgassing                                                                                  RF Foam thickness: 0.125 - 0.250 (3,18 - 6,35)

                                         -67 to 302F (-55 to 150C)                                                                     Pressure-sensitive adhesive

                                         Solid extrusions:rectangular,round ,"D",and U-channel Rectangular, strip, flat sheets; die-cut  Infinite die-cut shapes and molded parts
                                         Hollow extrusions:square,round,"D","P",modified shapes
                                         standards, cut-to length sheets

                                         Groove, pressure-sensitive adhesive, channel      Groove, pressure-sensitive adhesive
                                         clip- on, mechanical fastening

                                         Large variation on extruded shapes, complex Complex die-cut shapes, bonded or

                                         die-cuts, and molded parts                        vulcanized

Moisture, rain seal                      Moisture, rain, jet fuel, and nuclear biological  Moisture and rain                             Moisture, rain, jet fuel, and nuclear
                                         chemical (NBC) UL compounds                                                                     biological chemical (NBC) UL compounds
In limited applications                                                                    Provides barrier against dust
                                         Excellent sealing against air and dust            Monel and aluminum wire are compatible        Available in limited applications
Available in four compounds to provide                                                     with a broad range of mating surfaces
galvanic compatibility with most mating  21 standard variations                                                                          Moisture, rain, jet fuel, and nuclear
materials                                                                                                                                biological chemical (NBC) UL co5mpounds

www.lairdtech.com                                                    All dimensions are in inches (millimeters) unless otherwise specified.
                 EMI ESSENTIALS

                 BOARD LEVEL SHIELDS
                 PRODUCT SELECTION GUIDE

                                                                                   Corner Feature

                                                              Traditional  Rigid               Full Drawn                  Full Drawn
                                                                Folded     Corner              w/ Flange                   Zero Flange

  BLS Design           Key Attributes &                                    Improves Flatness    Most mechanically rigid,   Similar to Full
Type / Features  Application Consideration                                   by increasing       but depth attainable is   Drawn, Tooling
                                                                                               material and configuration  more complex.
SINGLE PIECE             Simple low cost BLS Solution                      torsional rigidity
Single Piece                                                                                          dependent

                                                              Opt          Std                 Opt (height/matl limits)    Opt

TWO PIECE        Post Reflow Component Access for
Traditional
                 inspect, test, cleaning, etc. Various
      Frame
       Cover     cover retention features available           Opt           Std                Opt (height/matl limits)    Low Height
ReCovr                                                                     Opt                Opt (height/matl limits)      Option
                 to address rattling, EMI, and shock/                      Req'd
EZ Peel                                                                                                                       N/A
                 vibration concerns.                          Std

                 Optional pre-assembled deliverable

                 Lower total cost 2 piece solution.           N/A                              N/A                         N/A

                 Eaveless side wall for maximum

                 component access.

                 Support for legacy products.                 Std          N/A                 Opt

                 ReCovr can often be a more reliable

                 alternative. EZ Peel can utilize a

                 separate replacement cover if desired.

97-2000         Large BLS Applications. Can
      Frame
      Cover      accommodate internal walls for               N/A          N/A                 N/A                         N/A
                 EMI compartmentation.
BLS MATERIALS
MATRIX                                                        Std          N/A                 N/A                         N/A

        6        Material Type    Description / Specs                      Comments
                 CRS, Tin Plated  1010 / 1008 CRS
                                                                           High Permeability Material for low Freq Applications, Very Good Solderability,
                 Nickel Silver                                             Mitigation options for Tin Whisker Growth, Pre-plated, Bare stamped edges

                 Stainless Steel  CA770, CA752                             Environmental Performance & Aesthetic Quality, Good Mechanical /
                 Copper Alloys                                             Strength Properties, Good Solderability, Active Flux may be required

                                  Typical 301 and 316 Series               Environmental Performance, Good option for the cover of 2 piece designs

                                  Phosphor Bronze, Beryllium Copper, Brass Can be chosen for unique requirements that integrate spring contacts,
                                                                                Typically Plated for Solderability and/or corrosion resistance

                 www.lairdtech.com
EMI ESSENTIALS

Unique Product                         Mounting Features                                          Size & Shape
    Features
                            SMT                  Thru Hole      Pins, Tabs,  Interior   Typical   Low Height    Typical   Flatness
  ReMovl Pick &         Castellations            Loc Pins          Etc.       Walls    Material   (less than 2  Length   (Size Dep)
   Place Bridge                                                                        Thickness                & Width
                                                                                                     mm)

Easy removal of pick                        Through hole style
and place bridge for                        pin that engages
post reflow inspection                        to underside of
                                            PCB by mechanical
          N/A
                                               engagement.

                        Std                      Opt            Opt          No        0.2        Yes           10- 75 mm 0.08

        Opt             Std                      Opt            Opt          Opt       0.2        Yes           10- 75 mm 0.08

        N/A             N/A                      N/A            N/A          N/A       0.15       Yes           10- 75 mm 0.15

        N/A             Std                      N/A            Opt          No        0.3        No            10-40 mm 0.1

        N/A             Std                      N/A            Opt          No        0.12       Yes           10-30 mm 0.1

        N/A             Std                      Opt            Opt          Opt       0.4        No            50-300 mm 0.2

        N/A             N/A                      N/A            N/A          0.25      0.25       No            50-300 mm 0.2

Cost Position Applications

Best             Most common BLS solutions

Good             Hi Performance BLS solutions                                                                            7
                 (Mechanical & Environmental)
Better
Good             BLS Covers, Specialty Military

                 Specialty BLS applications
                 Integrated Spring Contacts

www.lairdtech.com
                EMI ESSENTIALS

       BOARD LEVEL SHIELDS

                    Whether it's a one-piece shield, multi-compartmental shield or precision contact, each solution Laird Technologies delivers is designed
                    to provide maximum performance within a minimum timeline. Laird Technologies produces metal electronic components for surface
                    mount applications in a variety of industries. Laird Technologies expertise in a number of key areas ensures that the part provided
                    not only performs, but also optimizes applications. After determining the right board level shield or contact design for an application,
                    Laird Technologies experts use the latest systems to develop part designs in just hours.
                    Laird Technologies experienced engineers and technical specialists look beyond the component to the total application.
                    They work with you to engineer the ideal finished product at the best value.

8

                    www.lairdtech.com
EMI ESSENTIALS

BOARD LEVEL SHIELDS
STANDARD DESIGN SHIELDS

STANDARD SURFACE MOUNT SHIELDS --
ONE-PIECE
Off the Shelf, On Spec and On Budget
Standard surface mount shields are available in both one-piece and two-piece designs. One-piece shields offer six sides of protection,
with the sixth side being the board itself. One-piece designs offer economical shielding protection where access to covered components
is not necessary. There are no tooling costs associated with either the one and/or two-piece standard design.

TYPICAL PROPERTIES AND PERFORMANCE                                          Features and Benefits:
ALL PART NUMBERS                                                             Available in both one-piece

PROPERTY                                TEST METHOD              RESULT       and two-piece designs
                                                                 < 0.10 mm   One-piece designs offer economical
Co-planarity                            LTWI-1119                >99%
                                                                 >99%         shielding protection
Solderability                           ANSI/JSTD-002            Passes      No tooling costs associated with one
                                                                 Passes
Solderability                           MIL-STD-202 Method 208   Passes       or two-piece standard designs
                                                                 Passes
Surface mount solderability             ANSI/EIA 638

Appearance                              LTIES-125

Adhesion                                ASTM B-571

3 Axis mechanical shock                 LTES-461

STANDARD ONE-PIECE BOARD LEVEL SHIELDS

PART           MAXIMUM       MAXIMUM    MAXIMUM        PARTS
NUMBER         OVERALL       OVERALL    OVERALL        PER REEL
               LENGTH        WIDTH      HEIGHT
               in (mm)       in (mm)    in (mm)        1000
                                                       700
BMI-S-101      .538          .476       .100           300
               (13,66)       (12,10)    (2,54)         225
                                                       250
BMI-S-102      .650          .650       .142           300
               (16,50)       (16,50)    (3,60)         120
                                                       625
BMI-S-103      1.032         1.032      .200
               (26,21)       (26,21)    (5,08)

BMI-S-104      1.260         1.260      .236
               (32,00)       (32,00)    (6,00)

BMI-S-105      1.500         1.000      .236
               (38,10)       (25,40)    (6,00)

BMI-S-106      1.450         1.326      .200
               (36,83)       (33,68)    (5,08)

BMI-S-107      1.747         1.747      .384
               (44,37)       (44,37)    (9,75)

BMI-S-111      1.032         1.032      .079
               (26,21)       (26,21)    (2,00)

                                                                                                                                                                          9

www.lairdtech.com
    EMI ESSENTIALS

    BOARD LEVEL SHIELDS
    STANDARD DESIGN SHIELDS

    STANDARD SURFACE MOUNT SHIELDS --
    TWO-PIECE
    Reduce Board Damage From Inspection and Repairs
    Two-piece board level shields offer users the flexibility to inspect or repair shielded components without having to risk board damage by
    removing the entire shield or incur any tooling costs. Covers snap on and off with ease, which makes repair of the component under the
    shield quicker and easier and reduces board re-work. Two-piece shields are available unassembled*, and are designed to survive drop,
    shock and no-rattle tests.
    *Pre-assembly is an option. Consult sales

    STANDARD TWO-PIECE BOARD LEVEL SHIELDS

    PART               OVERALL   OVERALL    OVERALL                PARTS                   Features and Benefits:
    NUMBER             LENGTH     WIDTH     HEIGHT                 PER REEL                Offers flexibility to inspect
                       in (mm)   in (mm)    in (mm)                1000
                                                                   700                       or repair shield components
    BMI-S-201-F         .538      .476      .100                   300                       without risking board
                       (13,66)   (12,10)    (2,54)                 225                       damage
                                                                   250                      Covers snap on and off
    BMI-S-202-F         .650      .650      .142                   300                       with ease
                       (16,50)   (16,50)    (3,60)                 120
                                                                   400
    BMI-S-203-F        1.032     1.032      .200                   370
                       (26,21)   (26,21)    (5,08)                 250
                                                                   250
    BMI-S-204-F        1.260     1.260      .236                   250
                       (32,00)   (32,00)    (6,00)

    BMI-S-205-F        1.500     1.000      .236
                       (38,10)   (25,40)    (6,00)

    BMI-S-206-F        1.450     1.326      .200
                       (36,83)   (33,68)    (5,08)

    BMI-S-207-F        1.747     1.747      .384
                       (44,37)   (44,37)    (9,75)

    BMI-S-209-F        1.156     0.728      .275
                       (29,36)   (18,50)    (7,00)

    BMI-S-210-F        1.732     1.201      .118
                       (44,02)   (30,50)    (3,00)

    BMI-S-230-F        1.500     2.000      .200
                       (38,10)   (50,80)    (5,08)

    BMI-S-230-F-R      1.500     2.000      .200
                       (38,10)   (50,80)    (5,08)

    BMI-S-305          1.500     1.000      .236
                       (38,10)   (25,40)    (6,00)

    DESIGN PARAMETERS ALL PART NUMBERS

    PICK-UP SPOT       MATERIAL                                              THICKNESS     MATERIAL
    DIAMETER MATERIAL                                                        CARRIER TAPE
                                                                                           LTIMS-LCB
    6 mm or greater 0,20 mm CRS Tin, Nickel Silver, 300 Series SS            0,20 mm       DIAMETER
                                                                                           EIA-481
    COVER TAPE         MATERIAL                                              REEL

    LTIMS-PSA          330 mm (101, 102, 103, 104, 201, 202, 203, 204) Plastic
                       381 mm (105, 106, 107, 205, 206, 207)

10

    www.lairdtech.com
EMI ESSENTIALS                                                                                                        Features and Benefits:
                                                                                                                      Easy removal of scored cover area
BOARD LEVEL SHIELDS                                                                                                    Only requires 1.5 lbs force for
EZ PEELTM
                                                                                                                        cover removal
PATENTED SHIELDS ARE SCORED TO ALLOW PEEL-OFF WHEN ACCESS IS NEEDED                                                    Simple replacement technique

These patented shields have a solid top, scored to allow peel-off when access to board level components within          for cover
the shield is required.                                                                                                Use on surface mount or
The peel-off feature prevents damage to the board and components by eliminating the need for labor intensive
de-soldering, which can often result in increased scrap. Peeling off the cover is accomplished by using a small         through-hole applications
starter hole for simple removal. This hand operation requires minimal force using a hook scriber or tweezers.          Shield retains all physical
After repair, replacement or adjustment of internal components, the shield can be resealed using a replacement
cover. Laird Technologies offers two replacement cover options: a snap-in cover and a dish cover.                       properties after PCMCIA/JEIDA
The snap-in cover utilizes a lance and hole design. The replacement cover snaps into place and locks into a lance       testing for shock, bending, torque,
feature on the frame of the original shield.                                                                            drop and vibration
The other option is a dish cover that gets soldered into place on the board. The dish shape allows for self-location   CRS 1008/1010 (tin plated)
of the cover for soldering.                                                                                             for solderability
EZ Peel board level shields can be packaged in tape and reel formats for easy SMT installation using conventional
pick-and-place equipment. The four standard sizes are also available without the EZ Peel (scored) feature.

RIGID CORNER

The rigid corner board-level shield incorporates a corner design that optimizes component rigidity for increased part and printed circuit board
(PCB) firmness. As PCB designers are increasingly using thinner substrates, a rigid frame reinforces the assembly, thereby improving overall
ruggedness and performance. The shield has improved solder joint reliability and resistance to solder joint fracture, especially in drop testing
performance with thin PCBs. Several standard Laird Technologies EMI style parts including single-piece, two-piece, and multi-compartmental
board-level shields use this new rigid corner design, along with availability in custom sizes as well.

The rigid corner shield is stronger and more robust than traditional formed shields, which results in coplanarity improvement of the solder
castellations. The shield can tolerate more deflection (i.e., more handling) without plastic deformation. Elimination of drawn flange reduces
the space needed on the PCB for shielding trace width by potentially ~0.3 mm, allowing for the shield to be more closely placed on the PCB.
Elimination of draft allows for more undershield space and improved component clearance.

The partially drawn corner is located near the top portion the shield, resulting in improved torsional rigidity with no drawn lip and no draft.
For parts over 2 mm, the corner is both drawn and formed with an interlocking multi-radius corner, which provides superior EMI shielding
effectiveness. The interlocking corner can be meshed and closed in during the forming and drawing process for additional improved rigidity
for parts taller than 2 mm. For parts under 2 mm, the entire corner is drawn without an interlocking corner.

FEATURES                                        MARKETS

Corner openings are reduced,                   Computing

improving shielding performance                  Telecommunications

Partially drawn corner located near the top    Data Transfer and Information

portion of the corner combined with 90         Technology

straight forming of wall sections for improved   Automotive

torsional rigidity.                              Consumer Electronics

U.S. Patent No. 7,488,902                      Aerospace / Defense

                                                 Medical

                                                 Portability

                                                 Industrial & Instrumentation

                                                 Public Utilities                                                                                11

www.lairdtech.com
EMI ESSENTIALS

BOARD LEVEL SHIELDS
RECOVRTM

The proprietary and patented ReCovrTM product line incorporates the functionality of a two-piece shield without the need for a separate

frame and cover. The shield is specially designed with a locking mechanism that allows for easy removal of the shield cover when access

to board-level components is required. The locking mechanism makes repair of components under the shield quick and easy by eliminating

the need for removing the entire shield and reducing board re-work. The removable top shield also integrates Laird Technologies' patented

rigid corner board-level shield technology, which incorporates a new corner design that optimizes component rigidity for increased part

and printed circuit board (PCB) firmness.                                                                                                                                                                                                                                                            8                                       7                               6                                           5

FEATURES                                                                                                                                                                            MARKETS OR APPLICATIONS                                                                                                                                                                                                                                               REM
                                                                                                                                                                                                                                                                                                                                                                                                                                                          SOL

Single-piece board-level shield with a removable                                                                                                                                    Computing
   top cover                                                                                                                                                                                                                                                                                      D

                                                                                                                                                                                     Telecommunications / Datacom

Eave-less side walls when the cover is removed                                                                                                                                     Automotive                                                                                                                          4.05                          5.00 TYP
SMT or through-hole pin configurations available
U.S. Patent No. 7504592                                                                                                                                                            Consumer Electronics                                                                                                                .159                          .197
Other characteristics typical to one-piece shields: vent
                                                                                                                                                                                 8             7                           6                                      5                                                                                     4                             3E                                    2
   hole patterns, castellations, trace clearance notches, etc.                                                                                                                                                                                                                                                                              REMOVABLE LID AFTER                                                              REV.
                                                                                                                                                                              D      SMART Metering                                                      2.70                                                                              SOLDER TO BOARD                                      25.400                                               REVISIO
                                                                                                                                                                                                                                                          .106                                                                                                                                    1.000                        A         DESCRIPTION
BENEFITS                                                                                                                                                                            Aerospace / Defense                          C
                                                                                                                                                                                                                                                       5.00 TYP                                                                                                                                             X                           INITAL RELEASE
Eliminates need for replacement covers                                                                                                                                                                                                               .197
Offered as an assembled product only: tape and reel,                                                                                                                               Medical                                                                                                                                                                                                                            2.41
                                                                                                                                                                                                                                                         2.36 TYP                                                                                                                                                        .095
   tray pack, or layer pack                                                                                                                                                          Industrial & Instrumentation                                     .093                                                                                             2.35
                                                                                                                                                                              C                                                                                                                                                                         .093                                                                         DETAIL E
                                                                                                                                                                                    4.05          5.00 TYP                                                                                                                                                                                                                         SCALE 10 : 1
Excellent for periodic testing or rework applications.                                                                                                                                                                                                                                                                                                38.100
Limited footprint configurations (L-shapes, etc)                                                                                                                                  .159          .197                                                                                                                                                   1.500
Available in select Laird Technologies standard
                                                                                                                                                                                                                                E                                                                                                                                   X  R0.9
   board-level sizes or custom configurations                                                                                                                                                                                                                                                                                                                          .033
                                                                                                                                                                                                                                   B
                                                                                                                                                                             B      2.70                                                                                                                   6.000                                                                                                            RECOVR SCORE LINE
                                                                                                                                                                                    .106                                            25.400                                                           X .236                                                                                                                 MAXIMUM SHEAR REQ
                                                                                                                                                                                                                                     1.000
                                                                                                                                                                                 5.00 TYP                                                                                                              2.525.401 TYP                                                                                        X
                                                                                                                                                                                 .197                                                           X                                                       .1.00095                                                                                 0.100 [.0039] ALL SURFACES

                                                                                                                                                                                    2.36 TYP                                                                                                                              3.00D0 ETTYAPIL E                            3.020.401 TYP
                                                                                                                                                                                  .093                                                                                                                                    .11SC8 ALE 10 : 1                            .1.10895

                                                                                                                                                                                       6.000      38.100                                                                                                                       NOTE: CRITICAL DIMENSIONS ARE DESIGNATED B
                                                                                                                                                                                 X .236                                            A
                                                                                                                                                                                                  1.500
                                                                                                                                                                                                             X                                                                                                                                                                                  Block tolerances apply to               UNITS: MM (INCH)

                                                                                                                                                                                                                                                                                                                                                              This 2d drawing is generated      metric units only. Dual                 TOLERANCES:

                                                                                                                                                                                                                                                                                                                                                              from a 3d solid model. Refer      dimensions shown are for                 .X = .4
                                                                                                                                                                                                                                                                                                                                                                                                                                         .XX = .2
                                                                                                                                                                                                                                                                                                                                                              to 3d model for any dimensions reference only and are                      .XXX = .1
                                                                                                                                                                                                                                                                                                                                                                                                displayed in 3 places for
                                                                                                                                                                                                                                                                                                                                                              not shown on this drawing. 3d  F  conversion purposes only.                ANGULAR:              3RD AN
                                                                                                                                                                                                                                                                                                                                                              model dimensions will always                                              X.X = 3.0             PROJEC
                                                                                                                                                                                                                                                                                                                                                                                                                                        X.XX = 1.0
                                                                                                                                                                                                                                                                                                                                                              take precedent over drawing         CAD MAINTAINED   STD PART REFERENCE:                    DESIGNED
                                                                                                                                                                                                                                                                                                                                                              dimensions.                        DRAWING. MANUAL
                                                                                                                                                                                                                                                                                                                                                                                             CHANGES UNAUTHORIZED  BMIS-105

                                                                                                                                                                                                                                                                                                     X8                                      7                               6                                           5

REMOVLTM                                                                                                                                                                            2.550 TYP                                      0.100 [.0039] ALL SURFACES                                                                                                                               2.200 TYP
                                                                                                                                                                                    .100                                                                                                                                                                                                    .087

                                                                                                                                                                                                                     3.000 TYP

                                                                                                                                                                                    3.000 TYP                        .118

                                                                                                                                                                                    .118

                                                                                                                                               NOTE: CRITICAL DIMENSIONS ARE DESIGNATED BY X
                                                   A

The ReMovl feature incorporates the ReCovr attachment mechanism applied to the pickup bridge of a BLS frame to allow for easy, This2ddrawingisgenerated                                                                                                                                                                                                                                          THICKNESS:)                            PART NUMBER :
                                                                                                                                                                                                                                                                                               from a 3d solid model. Refer
                                                                                                                                                                                                                                   Block tolerances apply to                                                              UNITS: MM (INCH)                          MATERIAL:                              0.25 0.020                      BMI-S-305
                                                                                                                                                                                                                                   metric units only. Dual                                                                  TOLERANCES:                                                                   [.0100 .0008]
                                                                                                                                                                                                                                   dimensions shown are for                                                                                                                 1008/1010 CRS
                                                                                                                                                                                                                                                                                                                          .X = .4                                        FULL HARD TEMPER
                                                                                                                                                                                                                                                                                                                          .XX = .2
                                                                                                                                                                                                                                   reference only and are                                                                 .XXX = .1
                                                                                                                                                                                                                                   displayed in 3 places for
                                                                                                                                                                                                                                   conversion purposes only.                                                              ANGULAR:
tool less detachment of the bridge after the frame is soldered to the PCB. Ease of detachment along with reliable and consistent to3dmodelforanydimensions
                                                                                                                                                                                                                                                                                               not shown on this drawing. 3d
                                                                                                                                                                                                                                                                                               model dimensions will always
                                                                                                                                                                                                                                                                                               take precedent over drawing
                                                                                                                                                                                                                                   CAD MAINTAINED                                                    STD PART REFERENCE:                    3RD ANGLE               FINISH:                       PRODUCTION DRAWING                    INFORMATION CONTAINED IN THIS
                                                                                                                                                                                                                                                                                                                                            PROJECTION                                            CONTROLLED DOCUMENT                      AND PROPRIETARY TO LAIRD TEC
                                                                                                                                                                                                                                                                                                                                                                        1.25-5.00 MICRONS THICK
                                                                                                                                                                                                                                                                                                                                                                               100% MATTE TIN    ROHS COMPLAINT: (BASE PART)            DISCLOSED TO ANYONE WITHOUT
                                                                                                                                                                                                                                                                                                                                                                                                                                                                      LAIRD TECHN
separation force will allow for automated detachment.                                                                                                                                                   dimensions.                 BMIS-105 DRAWING. MANUAL                                                              X.X = 3.0         DESIGNED IN SOLIDWORKS                                               YES
                                                                                                                                                                                                                                                                                                                          X.XX = 1.0                                                                                                      SCALE: 2:1
                                                                                                                                                                                                                                   CHANGES UNAUTHORIZED

                                                                                                                                                                                 8             7                           6                                                                             5                                      4                                     3                                     2

FEATURES                                                                                                                                                                         MARKETS

Detachment is permanent cannot be replaced like                                                                                                                               Ideal for customer manufacturing processes where
   ReCovr                                                                                                                                                                           post reflow detachment of the pickup bridge is required or
                                                                                                                                                                                    desired. Applications that often require the bridge to
Min Height: 2.0 mm (.080") Lower heights required                                                                                                                                 be detached include:
   Product Development Review                                                                                                                                                       Inspection
                                                                                                                                                                                     Rework
Top Flange Width: 1.8 mm (.071")                                                                                                                                                   TIM Assembly into cover
Flatness: Part Size Dependent, but typical to other                                                                                                                               Cover with contact fingers to chip, etc.
                                                                                                                                                                                     Noise / Vibration concerns of bridge to cover
   Frame BLS parts
Configurations Min 4 legs/branches required

   (see BLS Style options)
Limitations: Must be folded or rigid corner type BLS.

   (No fully drawn parts.)
Pull Force (Typ) 0.5 1.0 lbs

Note: Due to delicate nature of the attachment of the pickup bridge, there will be some risk to the bridge separating during pick and
place operations depending on customer manufacturing processes. Pick and place head depth tolerance (z axis) -.020"

12

                     www.lairdtech.com
EMI ESSENTIALS

BOARD LEVEL SHIELDS

INTRODUCTION                                                                                                                                                                                              Series 97-2100
The complexities of today's electronics pose several design challenges.
Resolving EMI needs to be balanced with space, weight and production                                                             MULTI-COMPARTMENTAL SHIELD DESIGN
restraints. When designing a custom shielding solution, beginning in the                                                         SHIELD MULTIPLE CIRCUIT GROUPS SAVE PCB SPACE AND PRODUCTION
earliest stages of the application design allows effective elimination of EMI                                                    TIME
while meeting all specifications.                                                                                                Multi-compartmental shields feature internal dividing walls of one material
Laird Technologies board level shielding experts work through all phases of                                                      thickness and meet all on-board shield requirements for FCC, VDE, CISPR
development. From design, rapid prototyping and pre-production through                                                           and CE. These shields are available in two-piece designs, either assembled
production and automated packaging, Laird Technologies has the experience                                                        or unassembled. Our unassembled versions allow for automatic optical
to help speed a product to market and stay within budget.                                                                        inspection prior to cover placement. As in all our shielding offerings,
To increase manufacturing throughout and reduce costs, Laird Technologies                                                        Laird Technologies proprietary process for 100% automatic optical
has developed a proprietary in-line production process that includes part                                                        inspection verifies co-planarity including inner walls.
formation, wash, assembly, inspection and automated packaging.
By integrating quality processes, board level shield quality and performance                                                     DRAWN BOARD LEVEL SHIELDS
is ensured from design stage through final packaging. One process is the                                                         SEAMLESS CORNERS ADDRESS HIGH-FREQUENCY LEAKAGE
automated co-planarity inspection system. Laird Technologies replicates the
customer application by measuring shields in the same plane as the printed                                                       As microprocessor speeds continue to increase, so does the potential for EMI
circuit board. This is accomplished without "securing" or "touching" shields,                                                    leakage through the smallest apertures in board level shields. Laird Technologies
which could throw off measurement and/or deform parts. Laird Technologies                                                        drawn board level shields are designed to provide additional near-field and
measures shields immediately prior to placement into carrier tape at speeds                                                      far-field circuit isolation (attenuation) at higher frequencies by eliminating the
that match automation packing.                                                                                                   apertures found in the corners of traditional board level solutions. Drawn board
Shield base materials include our exclusive Shield-LiteTM, CRS 1008/1010,                                                        level shields utilize small ground trace sizes, thereby preserving space on the
beryllium copper alloys, nickel-silver alloys, copper-based alloys and spring                                                    circuit board.
steels. All shields are fully solderable.
                                                                                                                                  Solid corner designs when additional circuit isolation (attenuation) is
ONE-PIECE SHIELD DESIGN                                                                                                             required at higher frequencies
LOW COST/EXCELLENT EFFECTIVENESS
Custom surface mount shields are available in both one-piece and                                                                  Available in custom heights up to .250" (6,4 mm) with length and width
two-piece designs. One-piece shields provide six sides of protection,                                                               dimensions from .300" (7,6 mm) to 2.0" (50,8 mm)
with the sixth side being the board itself. One-piece designs offer
economical shielding alternatives where access to covered components for                                                          Tape and reel packaging provides an economical and automated SMT
repair is not necessary.                                                                                                            attachment method

TWO-PIECE SHIELD DESIGN                                                                                                          Available in cold rolled steel, brass, stainless steel and nickel silver
QUICK, EASY REPAIR AND INSPECTION OF COVERED
COMPONENTS                                                                                                                        Molded Compartment Shields and Form-In-Place elastomers can be
Two-piece board level shields offer users the flexibility to inspect or repair                                                      combined with drawn board level shields to achieve shielding of
shielded components without having to risk board damage by removing                                                                 multiple components with a single part
the entire shield. Covers snap on and off with ease, making repairs quicker
and easier, and reducing board re-work. Two-piece shields are available                                                          Available with an EZ Peel scored cover feature; allows for easy top
pre-assembled or unassembled. Large locking dimples snap into slots on                                                              section removal for component repair and re-sealing
covers to provide mechanical retention force. Smaller grounding dimples
provide electrical grounding for proper shielding and to prevent rattle.                                                          Ventilation holes as needed for solder outgassing.
Two-piece shields survive drop, shock and no-rattle tests. Here are critical
test results:                                                                                                                     Online shielding effectiveness calculator
Able to withstand acceleration of 4g from 10 Hz to 2000 Hz for three
                                                                                                                                 SURFACE MOUNT SHIELDS MATERIAL VARIATIONS
  hours in each of three planes as per SAE J1455
Pass EN 50 155 for railway electrical equipment including vibration test                                                       RAW MATERIAL*           THICKNESS              COMMENTS
                                                                                                                                                           in (mm)
  of 30g from 5 Hz to 200 Hz in 3 directions and a shock test with 500 m/s
  for 11/ms                                                                                                                      Cold Rolled Steel       0.005 to 0.090 (0,127  Pre-plated Tin
Pass standard telecommunications drop tests [6 faces, dropped 1 meter                                                             1008/1010                   to 2,286)
  onto concrete floor]
                                                                                                                                 Nickel-silver alloys    0.004 to 0.016         No plating required
Notice: The data set forth in all text, tables, charts, graphs and figures herein are based on samples tested and are                                    (0,102 to 0,406)             for SMT
not guaranteed for all samples or applications. Such data are intended as guides and do not reflect product
specification for any specific part. Material properties are for reference only. Product testing by purchaser is recommended to                                                     solderability
confirm. Laird Technologies assumes no liability for product failure unless specifically stated in writing.
                                                                                                                                 Phosphor Bronze alloys  0.004 to 0.020         Pre-tempered & Preplated
www.lairdtech.com                                                                                                                                        (0,100 to 0,510)

                                                                                                                                 *Other materials may be available, please consult sales.
                                                                                                                                 Note: Co-planarity dependant on design

                                                                                                                                                                                                              13
    EMI ESSENTIALS

    FINGERSTOCK
    PRODUCT SELECTION GUIDE

         Application       Continuous Length    Std. Contact Strips
             Type            (Coil Products)       Reverse Bend
                                                  Contact Strips
    Enclosure Shielding                            Double Sided
    Gaskets & Contact                              Contact Strip

            Strips

                           Fixed Length Strips  Tape Mount                                Twist Series
                                                                                        Fold Over Series
                                                Clip-On Mount           Mini-Clip On
                                                                                           Low Profile
                                                                        Symmetrical     Low Profile with

                                                                             Twist         Edge Hook
                                                                                        Large Enclosure
                                                                       Contact Strips  Std Contact Strips
                                                                                         Reverse Bend
                                                                       Reverse Bend      Contact Strips
                                                                       Contact Strips
                                                                                          Double Sided
                                                                        Longitudinal      Contact Strip
                                                                          Contacts         All Purpose
                                                                                         S3 - Solid Top,
                                                                      Perpendicular /     Symmetrical,
                                                                     PCB Edge Contact
                                                                                             Slotted
                                                Track Mount                                 No-Snag

                                                Direct to Chassis /   Slot Mount        Brass Track with
                                                Extrusion Mount                           Rivet Mount
                                                                     Compact PCI -       Stainless Track
                                                 Internal Contact        Dot 10
                                                External Contact                       Stainless Track w/
                                                                     Variable Slot       Integral rivet
                                                                         Mount

                           Contact Rings

    Enclosure & PCB I/O's       D-Sub
                             Back Plane
                           DIN Connector

                               Gaskets
                                 USB

                              IEEE 1394
                             Fiber Optic

                                 GBIC
                               SFP/XFP

14  Contact / Grounding    SMT

    www.lairdtech.com
EMI ESSENTIALS

FINGERSTOCK

Engineered metal Fingerstock solutions from Laird Technologies dates from 1938. Laird Technologies specializes in designing miniature
parts of thin strip metal in quantities ranging from thousands of pieces to millions of pieces. With over 3,400 standard parts, Laird
Technologies probably already has an off-the-shelf solution that meets your application's requirements.
When custom designs are needed, Laird Technologies engineering staff helps construct efficiencies in performance, cost and
manufacturability from the very beginning stages of the application.
Laird Technologies specialized capabilities:
Assembly Heat staking (both hand and automatic)
Heat treating In-house die and fixture manufacturing
Multislide equipment Photoetching
Plating Progressive die stamping
Prototype fabrication Resistance welding
Riveting Secondary fabrication
Wire EDM

                                                                                                                                                                           15

www.lairdtech.com
                         EMI ESSENTIALS

                         FINGERSTOCK
                         MOUNTING METHODS

                         UNIVERSAL MOUNTING

                         A stainless steel mounting track is available for use with our full line of gasketing materials. Its unique design offers a secure mounting option versatile
                         enough for use with fingerstock, ElectroNit mesh, ElectroSeal elastomers, UltraSoft Knit and fabric-over-foam products.

                         PART NUMBER      WIDTH                               X  =  MATERIAL                                                                               0.356
                         0095-X996-00     0.310 (7.874)                             THICKNESS                                                                             (9.042)
                         0095-X997-00     0.430 (10.922)
                         0095-X998-00     0.600 (15.240)                                                                          0.145                              0.205                                                                               0.205
                                                                                                                                 (3.683)                            (5.207)                                                                             (5.207)

                 0.205                    MATERIAL THICKNESS                                                                                                        0.018                                DETAIL "A"
                (5.207)                   A = 0.030 (0.762)                                                                                                        (0.457)
                                          B = 0.045 (1.143)                                                                                                                                                                                 0.356
05                                        C = 0.060 (1.524)                                                                                                                              0.145                                             (09.305462)
07)                                       D = 0.090 (2.286)                                                                                                                             (03.164853)                                        (9.042)
                                          E = 0.150 (3.810)                                                                                                                             (3.683)                                       0.205
                                                                                                                                          X  =  MATERIAL                                                                             (05.2057)                       0.205
                                                                                                                                          X  =  TMHAICTKENRIEASLS                                                                    (5.207)                        (05.2057)
                                                                                                                                                THICKNESS                                                                                                           (5.207)
                                                                                               W                                                                                                     SEE DETAIL "A"

                                                                               0.699                                                                                                                  0.018                                             DETAIL "A"
                                                                              (17.755)                                                                                                               (0.041587)                                         DETAIL "A"
                                                                                                                                                                                                     (0.457)

                                                                                                                                                         W
                                                                                                                                                         W

                         Universal Mount                                                                                                                                                                                  SEE DETAIL "A"
                                                                                                                                                                                                                          SEE DETAIL "A"
                         To identify proper mounting track, select width and                                                               0.699          14.898     1.500                                        1.500
                         corresponding part number from the above chart.                                                                  (107.6.79595)  (378.409)  (38.100)                                     (318.5.10000)
                         Replace the "X" with required material thickness.                                                                (17.755)                                                               (38.100)
                                                                                                                                                                                                14.898
                                                                                                                                                                                               (31748.8.49089)
                                                                                                                                                                                               (378.409)

                                          ^ Shielding gaskets may be mounted for either
                                          wiping or compression closing applications.
                                          Proper positioning of the shielding gasket must
                                          take into consideration the closing design and
                                          the configuration of the mounting surface.

                                                                                                                                          Rivet Mount               Slot Mount

                         Laird Technologies shielding devices may be mounted quickly and easily using any of several                      Sticky Fingers Clip-On Mounting Tape Track Mount
                         different methods. Each installation method is described in the text that follows. However, if
                         you should run into a unique situation not resolved by any of these methods, give us a call.
                         More than likely we can provide the exact answer you need.

                              RIVET MOUNT                                                                                        4. Allow 24 hours minimum curing time.
                              Riveting produces a tight, long-lasting installation. Either plastic or metal rivets may be used.  Standard parts are supplied with nonconductive tape. For rough surface
                                                                                                                                 applications, such as flame-sprayed surfaces, 0.010 in. (0.254 mm) thick
                              SLOT MOUNT                                                                                         nonconductive tape is recommended. Optional conductive tape is also available.
                              Slot mounted parts are easily installed using slots where bi-directional movement is required.     Contact a sales department representative for additional ordering information.
                              Simply install part into one slot and snap it into the second slot or over the edge of the frame.
                                                                                                                                 CLIP-ON MOUNTING
                              ADHESIVE MOUNTING                                                                                  Clip-on gaskets hold firmly in place due to their own spring characteristics.
                              Sticky Fingers is an instant, pressure-sensitive adhesive bonding system, ideal for all-purpose   Simply push the strips onto the edge or flange of the door or enclosure.
                              contact strips for metal cabinets and electronic enclosures, and is unaffected by temperatures     Also available are clip-on gaskets with either "T" or "D" lances.
                              from -67 to +250F (-55 to +121C).
                              Simply follow these four easy steps:                                                               TAPE TRACK MOUNTING
                              1. Remove all grease and oily residue with solvent. Smooth the mounting surface with emery         Stainless Steel mounting track with PSA (pressure sensitive adhesive) is available
                              cloth.                                                                                             on the Symmetrical Slotted Series and Slot Mount Series.
                              2. Peel off protective paper backing.
                              3. Place gasket in correct position. (See mounting methods diagrams A through E.) Press firmly     WELDING
                              to ensure a good adhesive bond. Avoid repositioning, which might impair the effectiveness of       Welded mounting requires simple, traditional welding techniques.
                              the adhesive or may bend or kink the strip.
                              NOTE: On items where fingers cover the solid portion of the gasket, pressure may be applied        SOLDERING
                         16 by inserting a mandrel in the strip and pressing down. For contact strips with Magnefil insert,     Solder mounting requires normal low temperature soldering techniques,
                              simply press down on the fingers.                                                                  including cleaning and fluxing of parts with common copper flux materials.

                                          www.lairdtech.com
EMI ESSENTIALS

FINGERSTOCK
ORDERING INFORMATION

Part Number Format

Example:

Stock Item              Unique Part No.                             Finish I.D.
                                                                       02
     0097   --              0520                      --

In the above example, Laird Technologies part number 0097-       Standard plating finish is 0.0001 in. (0.0025 mm) min. [gold
    0520-02 is a 97-520 RFI/EMI shielding gasket with a bright         0.00005 in. (0.0013 mm) min.] but can be varied to meet
    finish                                                             your custom needs

When ordering UltraSoft items, the stock item prefix will       Modifications to standard parts are specified by an X
    be 0098 or 0078. The above example in UltraSoft would be           (following finish I.D.) for quoting only. Upon ordering,
    0098-0520-02.                                                      a specific part number will be assigned.

When ordering coil, the prefix 0C should precede the stock       For tape options, see Adhesive Mounting -- Sticky Fingers
    item number; for example: 0C97, 0C98, 0C77 or 0C78                 on page 16

When ordering stainless steel items, the stock item prefix will   Use the catalog number for the unique part number and refer
    be 0095                                                            to the following chart for finish I.D.

Plating Finishes

Finish Designation Finishes for Fingerstock Products Laird Specifications                      Specification Details*

            (BeCu and RCC)                            ID

Unplated    Bright Finish                             02 Laird Designation                     Unplated, Bright or Ultrasoft surface

            Solderable Unplated                       21 Laird Designation                     Solderable bright finish

Gold        Gold                                      03 ASTM B 488 / SAE AMS 2422             Type I & II, grade C, 1.27 - 2.5 m thick

            Gold/Nickel Underplate                    10 ASTM B 488 / SAE AMS 2403             Type I & II, grade C, 1.27 - 2.5 m thick

Silver      Silver (matte)                            04 ASTM B 700 / QQ-S-305                 Type II, grade A, 2.5 - 7.6 m thick

Cadmium**   Cadmium + Yellow Chromate                 05 ASTM B 766 / AMS QQ P 416             Type II, class 5, min 5 m thick

            Cadmium + Clear Chromate                  06 ASTM B 766 / AMS QQ P 416             Type III, class 5, min 5 m thick

Tin Lead**  Tin Lead [60/40] Solder                   07 ASTM B 579 / SAE AMS P 81728          7.6 - 12.7 m thick

Nickel      Dull Nickel                               09 ASTM B 689 / SAE AMS 2403 (QQ-N-290)  2.5 - 7.6 m thick*

            Bright Nickel                             19 ASTM B 689 / SAE AMS 2403 (QQ-N-290)  2.5 - 7.6 m thick*

            Sulfamate Nickel                          24 ASTM B 689 / SAE AMS 2424             2.5 - 7.6 m thick (1.27 - 2.5 m underplate)

Electroless Nickel Electroless Nickel                 18 ASTM B 733 / SAE AMS C 26074          2.5 - 7.6 m thick

Tin         Satin / Matte Tin                         08 ASTM B 545 / MIL-T-10727C             Type I, 2.5 - 7.6 m thick

            Bright Tin                                17 ASTM B 545 / MIL-T-10727C             Type I, 2.5 - 7.6 m thick

Zinc***     Zinc + Yellow Chromate                    16 SAE AMS 2402 / ASTM B 633             Type II, 2.5 - 7.6 m thick

            Zinc + Clear Chromate                     15 SAE AMS 2402 / ASTM B 633             Type III, 2.5 - 7.6 m thick

Notes:
- Laird Technologies' standard plating codes are defined according to the above specifications. Any non-standard requirements (different classes or types within a
specification) must be clearly identified on the production prints.
- The plating thickness indicates the thickness measured on the primary out-surface of fingerstock products.

* Class 1, Grade G in QQ-N-290
** Outsourced process
*** Laird provides RoHS compliant Trivalent Chromate

                                                                                                                                                                          17

www.lairdtech.com
    EMI ESSENTIALS

    FINGERSTOCK
    ULTRASOFT SERIES

    Series UltraSoft fingers have been designed for communications, computers and electronic systems designers concerned with EMI

    compliance and lightweight enclosure designs. Available in the same full range of standard configurations, UltraSoft fingers offer
    designers greater flexibility and versatility than ever before--permitting more extensive use of lighteFr,OtLhDiOnVnEeRrScERoInESstruction materials
                                                                                                                                                                                  Standard No. 97-541
    to help cut costs and/or enhance system performance.
                                                                                                                                                                                  UltraSoft No. 98-541

    The unique advantages of UltraSoft (98-Series) fingers include:

                            The lowest compression forces in the industry                                                                       160

                                                                                                                                                  140

                            Shielding effectiveness comparable to similarly configured standard 97-1S2e0 ries parts
                                                                                                                          Attenuation (dB)
                            Wide selection of sizes and configurations                                                                          100

                                                                                                                                                  80

                            Low compression force version available for virtually every standard shie6l0ding product

    UltraSoft (98-Series) products are available in the same lengths as the stand40ard (97-Series) products. Please refer to the appropriate
                                                                                                                                                                                                       20

    standard product pages for specific information. All UltraSoft products are al0so available in your choice of finishes.

                                                                                                                                                       10K      100K          1M                    10M         100M   1G

                                                                                                                                                                                  Frequency (Hz)

    Shielding Effectiveness Comparison                                                                                    Compression Force Comparison

                                                   FOLDOVER SERIES                                                                                                 Standard No. 97-541
                                              Standard No. 97-541                                                                                                  UltraSoft No. 98-541
                                              UltraSoft No. 98-541
                                                                                                                                                                       1.500  Height (Millimeters)       2.500         3.000
                                                                                                                                                                       0.060          2.000                                       140

                            160                                                                                                                   100                                                                  120
                            140                                                                                                                    90
                            120                                                                                                                    80                                                                  100             Load (Kg/linear m)
                            100                                                                                                                    70
    Attenuation (dB)                                                                                                      Load (Lbs./linear ft.)   60                                                                  80
                             80                                                                                                                    50
                             60                                                                                                                    40                                                                  60
                             40                                                                                                                    30
                             20                                                                                                                    20                                                                  40
                                                                                                                                                   10
                               0                                                                                                                     0                                                                 20
                                 10K                                                                                                                     0.040
                                      100K         1M                    10M         100M         1G                                                                                                                              0
                                                                                                                                                                                                                       0.120
                                                       Frequency (Hz)                                                                                           0.050         0.070 0.080 0.090          0.100  0.110
                                                                                                                                                                                       Height (Inches)

                                                       Standard No. 97-541

    R E C Y C L A B L E C L E A N UltraSoft No.98-541 C O P P E R TM
                                                   Height (Millimeters)

                                            1.500      2.000                  2.500        3.000

              100Load (Lbs./linear ft.)                                                                        140Load (Kg/linear m)                                   Recyclable Clean Copper (RCC) beryllium-
                                                                                                                                                                       free EMI shielding offers customers an
    Recyc90lable Clean Copper products meld                                   The product is targeted at high                                                          excellent alternative to beryllium containing
    stron8g0 stability and tensile strength                                                                    120                                                     alloys (BeCu) in a wide range of slotted
                                                                                                                                                                       applications. The conversion of part number
               70                                                             volume designs. Custom stampings                                                         (Stock Item) of BeCu to RCC:
                                                                              are available 1u00pon customer request.
    with high levels of thermal and
               60                                                             As with all of80Laird Technologies metal

    elect5r0ical conductivity making it suitable                              fingerstock ga60skets, Recyclable Clean
    for u4t0ilization in both grounding and

    shield30ing applications at a cost that is Copper is com40pletely flameproof.

    comp20arable with traditional metal EMI For mounting20methods and other spe-
    shield10s. Shielding effectiveness is similar
    to oth0e0r.04c0opp0.e05r0 all0o.0y60s wi0t.0h70valu0.0e80s o0v.0e90r         cific product i0nformation, please                                                               BeCu                          RCC
                                                                              0.100 see0.1L10aird0.1T2e0 chnologies catalog                                                       0077-                         0067-
    100 dB shielding effectiveneHsesighrt e(Inacheds)ily                                                                                                                          0c77-                         0c67-
                                                                                 "Fingerstock, Gaskets and Metal
    achieved.
                                                                              Grounding Products".

    Recyclable Clean Copper is fully                                          To find out more about this exciting new                                                            0097-                         0087-
    compliant to EU Directive 2002/95/EC                                      product available from Laird Technologies                                                           0c97-                         0c87-
    and alleviates the environmental, safety                                  please contact sales for assistance or visit                                                        0078-                         0068-
    and segregation concerns associated                                       us at www.lairdtech.com.                                                                            0c78-                         0c68-
    with the traditional use and recycling                                                                                                                                        0098-                         0088-
    of beryllium-based copper alloys.                                                                                                                                             0c98-                         0c88-

    This alternative material exhibits
    excellent corrosion resistance,

    platability, solderability and stress

18  relaxation properties.

                                      www.lairdtech.com
EMI ESSENTIALS

FINGERSTOCK
SLOT MOUNT SERIES

                                                                                                          Laird Technologies' Slot Mount Series of beryllium copper shielding gaskets
                                                                                                          is designed for use in a wide variety of slotted applications. This economical
                                                                                                          product line is ideal for both grounding and shielding applications.

                                                                                                          Minimal slot fabrication cost

                                                                           77-011                         Easy and cost-effective installation since fasteners and adhesives are not
                                                                    77-011                                required

                                                                        77-010                            Bi-directional wiping and compression action to accommodate a wide
                                                                  77-010                                  variety of designs

      77-015                                                                                              Ideal for grounding and shielding in the following electronic enclosure
77-015                                                                                                    applications:

                      77-018                                                                               Front panel handles             Chassis covers
               77-018
                                                                                                          Plug-in units                   Backplanes
                                                     TOP VIEW
                                              TOP VIEW                                                       Subrack assemblies
                                                                                                          Standard (77-Series) and UltraSoft (78-Series low compression versions)
                                                                                                          are also supplied in 25.0 ft. (7.6 m) coils

                                                                                                          The Slot Mount Series is available in your choice of finishes, see page 17.

                                                                                                       A                                                              *N
                                                                                             A                                                               *N

                                                                                                                                                                               *O
                                                                                                                                                                     *O

                                                               E

          D Pitch                              E Slot                                                                          *P                   Length of slot is dependent on
D Pitch                                       Slot                                                                     Material                     the number of fingers used
                                                                                                                   T*hPickness             Length of slot is dependent on
                                                                                                             Material                      the number of fingers used
                                                                                                          Thickness
                              Approx. Length

Approx. Length

                                                                               See page 2-2                        Recommended Mounting Hole Pattern                      See page 2-2
                                                                           for dimensions.                Recommended Mounting Hole Pattern                           for dimensions.
                                                                     See page 2-2                                                                               See page 2-2
                                                                  for dimensions.                                                                            for dimensions.

                                     RIGHT VIEW
                              RIGHT VIEW

                                                              B

                                                    B

                                                       H
                                              H

                                                       M
                                              M

         C
C

See page 2-2                                  Q Radius (R)                                                                                                                See page 2-2
                                                                                                                                                                      for dimensions.
for dimensions.               Q Radius (R)                                                                                                                      See page 2-2
See page 2-2                                                                                                                                                 for dimensions.

for dimensions.

Slot Mount Series are available with Universal and Tape Track mounting

Slot Mopotuionnt sS,esreieespaargeea1va-9il,a1bl-e10w.ith Universal and Tape Track mounting

options, see page 1-9, 1-10.                                                                                                                                                              19

www.lairdtech.com
EMI ESSENTIALS

FINGERSTOCK
SLOT MOUNT SERIES

SLOT MOUNT SERIES DIMENSIONS                                                                                                                                       SERIES A B C D E H M *N *O *P Q
                                                                                                                                                                                                                                                RECOMMENDED (R)
SERIES A B C D E H M *N *O *P Q LENGTH # OF
                                                                              RECOMMENDED (R) APPROX. FING.                                                        77-010 0.320 0.110 0.004 0.187 0.018 0.085 0.110 0.090 0.260 0.040 0.02
                                                                                                                                                                            (8.128) (2.794) (0.102) (4.750) (0.457) (2.159) (2.794) (2.286) (6.604) (1.016) (0.508
77-010 0.320 0.110 0.004 0.187 0.018 0.085 0.110 0.090 0.260 0.040 0.020 16.000 86
          (8.128) (2.794) (0.102) (4.750) (0.457) (2.159) (2.794) (2.286) (6.604) (1.016) (0.508) (406.400) --   SERIES A B C D E H M *N *O *P Q LENGTH # OF
                                                                                                                                                                   77-011 0.600 0.220 RE0C.0O0M5 ME0N.2D8E2D 0.032(R)0.140APP0R.O18X0. FI0N.1G4.0 0.520 0.070 0.04
77-011 0.600 0.220 0.005 0.282 0.032 0.140 0.180 0.140 0.520 0.070 0.040 16.000 57
         (15.240) (5.588) (0.127) (7.163) (0.813) (3.556) (4.572) (3.556) (13.208) (1.778) (1.016) (406.400) --  77-045 0.320 0.110 0.004 N/A N/A 0.08(155.204.01)1(05.5808.0)9(00.1207.2) 6(07.1603.0) 6(0.8103.)04(30.556)0.(146.5972) (31.556) (13.208) (1.778) (1.01
                                                                                                                          (8.128) (2.794) (0.102) -- --77-0(21.51590).6(20.07940) .2(22.02860) .0(065.604)N/(A1.524N) /(A1.0106.)140(4.209.138) 0 --0.140 0.520 0.070 0.040
77-015 0.600 0.220 0.005 N/A N/A 0.140 0.180 0.140 0.520 0.070 0.040 0.250 1
         (15.240) (5.588) (0.127) -- -- (3.556) (4.572) (3.556) (13.208) (1.778) (1.016) (6.350) --              77-046 0.320 0.110 0.004 0.187 0.018 0.0(8155.2400.1)1(05.5808.)09(0.1207.)260--0.060-- 0.0(34.0556) 0(4.3.5672) (3.2556) (13.208) (1.778) (1.016
                                                                                                                          (8.128) (2.794) (0.102) (4.750) (0.45777)-0(126.1590).32(20.7940).1(120.2860).00(64.604N) /A(1.524N)/A(1.0106.0)85 (9.00.4121)0 0--.090 0.260 0.040 0.020
77-016 0.320 0.110 0.004 N/A N/A 0.085 0.110 0.090 0.260 0.040 0.020 0.169 1
          (8.128) (2.794) (0.102) -- -- (2.159) (2.794) (2.286) (6.604) (1.016) (0.508) (4.293) --               77-047 0.320 0.110 0.004 0.187 0.018 0.08(85.1208.)11(02.7904.)09(0.1002.)260--0.060-- 0.0(24.0159) 0(2.5.74934) (2.3286) (6.604) (1.016) (0.508
                                                                                                                          (8.128) (2.794) (0.102) (4.750) (0.45777)-0(127.1590).32(20.7940).1(120.2860).00(646040).18(17.5204.)01(18.0106.)085(13.07.9121)0 --0.090 0.260 0.040 0.02
77-017 0.320 0.110 0.004 0.187 0.018 0.085 0.110 0.090 0.260 0.040 0.020 0.356 2
          (8.128) (2.794) (0.102) (4.750) (0.457) (2.159) (2.794) (2.286) (6.604) (1.016) (0.508) (9.042) --     77-048 0.320 0.110 0.004 0.187 0.018 0.08(85.1208.)11(02.7904.)09(0.1002.)26(40.750.)06(00.4570).0(420.159)0(.273.7094) (24.286) (6.604) (1.016) (0.508
                                                                                                                          (8.128) (2.794) (0.102) (4.750) (0.45777)-0(128.1590).32(20.7940).1(120.2860).00(64.6040).18(17.5204.)01(18.0106.)085(18.05.4121)0 --0.090 0.260 0.040 0.02
77-018 0.320 0.110 0.004 0.187 0.018 0.085 0.110 0.090 0.260 0.040 0.020 0.543 3
          (8.128) (2.794) (0.102) (4.750) (0.457) (2.159) (2.794) (2.286) (6.604) (1.016) (0.508) (13.792) --    77-050 0.320 0.110 0.004 0.187 0.018 0.08(85.1208.)11(02.7904.)09(0.1002.)26(40.750.)06(00.4570).0(420.159)0(.291.7794) (25.286) (6.604) (1.016) (0.508
                                                                                                                          (8.128) (2.794) (0.102) (4.750) (0.45777)-0(129.1590).32(20.7940).1(120.2860).00(64.6040).18(17.5204.)01(18.0106.)085(23.02.9121)0 --0.090 0.260 0.040 0.02
77-019 0.320 0.110 0.004 0.187 0.018 0.085 0.110 0.090 0.260 0.040 0.020 0.730 4
          (8.128) (2.794) (0.102) (4.750) (0.457) (2.159) (2.794) (2.286) (6.604) (1.016) (0.508) (18.542) --    77-051 0.320 0.110 0.004 0.187 0.018 0.08(85.1208.)11(02.7904.)09(0.1002.)26(40.750.)06(00.4570).0(420.159)1(.210.7494) (26.286) (6.604) (1.016) (0.508
                                                                                                                          (8.128) (2.794) (0.102) (4.750) (0.45777)-0(220.1590).60(20.7940).2(220.2860).00(65.6040).28(12.5204.)03(12.0106.)140(28.00.4128)0 --0.140 0.520 0.070 0.04
77-020 0.600 0.220 0.005 0.282 0.032 0.140 0.180 0.140 0.520 0.070 0.040 0.532 2
         (15.240) (5.588) (0.127) (7.163) (0.813) (3.556) (4.572) (3.556) (13.208) (1.778) (1.016) (13.513) --   77-052 0.320 0.110 0.004 0.187 0.018 0.0(8155.2400.1)1(05.5808.)09(0.1207.)26(70.1603.)06(00.8130.)0(430.556)1.(249.5172) (37.556) (13.208) (1.778) (1.01
                                                                                                                          (8.128) (2.794) (0.102) (4.750) (0.45777)-0(221.1590).32(20.7940).1(120.2860).00(64.6040).18(17.5204.)01(18.0106.)085(32.07.9111)0 --0.090 0.260 0.060 0.03
77-021 0.320 0.110 0.004 0.187 0.018 0.085 0.110 0.090 0.260 0.060 0.035 16.000 86
          (8.128) (2.794) (0.102) (4.750) (0.457) (2.159) (2.794) (2.286) (6.604) (1.524) (0.889) (406.400) --   77-053 0.320 0.110 0.004 0.187 0.018 0.08(85.1208.)11(02.7904.)09(0.1002.)26(40.750.)06(00.4570).0(420.159)1(.247.7894) (28.286) (6.604) (1.524) (0.889
                                                                                                                          (8.128) (2.794) (0.102) (4.750) (0.45777)-0(223.1590).37(20.7940).1(320.2860).00(64.604N) /A(1.524N)/A(1.0106.0)85(370.5.14110) 0--.090 0.300 0.040 0.020
77-023 0.370 0.130 0.004 N/A N/A 0.085 0.110 0.090 0.300 0.040 0.020 0.225 1
          (9.398) (3.302) (0.102) -- -- (2.159) (2.794) (2.286) (7.620) (1.016) (0.508) (5.715) --               77-054 0.320 0.110 0.004 0.187 0.018 0.08(95.3908.)11(03.3002.)09(0.1002.)260--0.060-- 0.0(24.0159) 1(2.6.76954) (2.9286) (7.620) (1.016) (0.508
                                                                                                                          (8.128) (2.794) (0.102) (4.750) (0.45777)-0(224.1590).37(20.7940).1(320.2860).00(64.6040).25(10.5204.)02(15.0106.)085(42.02.9111)0 --0.090 0.300 0.040 0.02
77-024 0.370 0.130 0.004 0.250 0.025 0.085 0.110 0.090 0.300 0.040 0.020 0.475 2
          (9.398) (3.302) (0.102) (6.350) (0.635) (2.159) (2.794) (2.286) (7.620) (1.016) (0.508) (12.065) --    77-055 0.320 0.110 0.004 0.187 0.018 0.08(95.3908.)11(03.3002.)09(0.1002.)26(60.350.)06(00.6350).0(420.159)1(.285.7294) (21.0286) (7.620) (1.016) (0.508
                                                                                                                          (8.128) (2.794) (0.102) (4.750) (0.45777)-0(225.1590).37(20.7940).1(320.2860).00(64.6040).25(10.5204.)02(15.0106.)085(47.00.4111)0 --0.090 0.300 0.040 0.02
77-025 0.370 0.130 0.004 0.250 0.025 0.085 0.110 0.090 0.300 0.040 0.020 0.725 3
          (9.398) (3.302) (0.102) (6.350) (0.635) (2.159) (2.794) (2.286) (7.620) (1.016) (0.508) (18.415) --    77-058 0.320 0.110 0.004 0.187 0.018 0.08(59.3908.)11(03.3002.)09(0.1002.)26(60.3500.)04(00.6305.)0(220.159)0.(921.7794) (25.286) (7.620) (1.016) (0.508
                                                                                                                          (8.128) (2.794) (0.102) (4.750) (0.45777)-0(226.1590).3(720.7940).1(320.2860).0(065.6040).2(510.0160.)02(05.5008.)085(23.02.9121)0 --0.090 0.300 0.040 0.02
77-026 0.370 0.130 0.005 0.250 0.025 0.085 0.110 0.090 0.300 0.040 0.020 0.975 4
          (9.398) (3.302) (0.127) (6.350) (0.635) (2.159) (2.794) (2.286) (7.620) (1.016) (0.508) (24.765) --    77-059 0.370 0.130 0.004 0.250 0.025 0.08(59.3908.)11(03.3002.)09(0.1207.)31(60.3500.)04(00.6305.)0(220.159)16(.20.07094) (26.4286) (7.620) (1.016) (0.508
                                                                                                                          (9.398) (3.302) (0.102) (6.350) (0.63757)-0(227.1590).3(720.7940).1(320.2860).0(075.8740).2(510.0160.)02(05.5008.)08(54060.4.10100) --0.090 0.300 0.040 0.02
77-027 0.370 0.130 0.005 0.250 0.025 0.085 0.110 0.090 0.300 0.040 0.020 1.225 5
          (9.398) (3.302) (0.127) (6.350) (0.635) (2.159) (2.794) (2.286) (7.620) (1.016) (0.508) (31.115) --    77-062 0.320 0.110 0.004 0.187 0.018 0.08(95.3908.)11(03.3002.)09(0.1207.)26(60.350.)04(08.6350).0(225.159)0(.216.7994) (21.286) (7.620) (1.016) (0.508
                                                                                                                          (8.128) (2.794) (0.102) (4.750) (0.45777)-0(228.1590).37(20.7940).1(320.2860).00(65.6040).25(10.2109.)02(05.6305.)085(4.209.131)0 --0.090 0.300 0.040 0.02
77-028 0.370 0.130 0.005 0.250 0.025 0.085 0.110 0.090 0.300 0.040 0.020 1.475 6
          (9.398) (3.302) (0.127) (6.350) (0.635) (2.159) (2.794) (2.286) (7.620) (1.016) (0.508) (37.465) --    77-063 0.320 0.110 0.004 0.187 0.018 0.08(95.3908.)11(03.3002.)09(0.1207.)26(60.350.)04(08.6350).0(225.159)0(.235.7694) (22.286) (7.620) (1.016) (0.508
                                                                                                                          (8.128) (2.794) (0.102) (4.750) (0.45777)-0(229.1590).80(20.7940).3(220.2860).00(64.604N) /A(1.219N)/A(0.6305.2)00 (9.00.4128)0 0--.220 0.720 0.070 0.040
77-029 0.800 0.320 0.004 N/A N/A 0.200 0.180 0.220 0.720 0.070 0.040 0.343 1
         (20.320) (8.128) (0.102) -- -- (5.080) (4.572) (5.588) (18.288) (1.778) (1.016) (8.712) --              77-064 0.320 0.110 0.004 0.187 0.018 0.0(8250.3200.1)1(08.1208.)09(0.1002.)260--0.048-- 0.0(52.5080) 0(4.5.45372) (5.3588) (18.288) (1.778) (1.016
                                                                                                                          (8.128) (2.794) (0.102) (4.750) (0.45777)-0(320.1590).80(20.7940).3(220.2860).00(64.6040).37(15.2109.)03(02.6305.)200(13.07.9128)0 --0.220 0.720 0.070 0.04
77-030 0.800 0.320 0.004 0.375 0.032 0.200 0.180 0.220 0.720 0.070 0.040 0.718 2
         (20.320) (8.128) (0.102) (9.525) (0.813) (5.080) (4.572) (5.588) (18.288) (1.778) (1.016) (18.237) --   77-065 0.320 0.110 0.004 0.187 0.018 0.0(8250.3200.1)1(08.1208.)09(0.1002.)26(90.5205.)04(08.8130.)0(255.080)0.(743.5072) (54.588) (18.288) (1.778) (1.01
                                                                                                                          (8.128) (2.794) (0.102) (4.750) (0.45777)-0(321.1590).80(20.7940).3(220.2860).00(65.6040).37(15.2109.)03(02.6305.)200(18.05.4128)0 --0.220 0.720 0.070 0.04
77-031 0.800 0.320 0.005 0.375 0.032 0.200 0.180 0.220 0.720 0.070 0.040 1.093 3
         (20.320) (8.128) (0.127) (9.525) (0.813) (5.080) (4.572) (5.588) (18.288) (1.778) (1.016) (27.762) --   77-070 0.320 0.110 0.004 0.187 0.018 0.0(8250.3200.1)1(08.1208.)09(0.1207.)26(90.5205.)06(02.8130.)0(355.080)16(.40.05072) (58.6588) (18.288) (1.778) (1.01
                                                                                                                          (8.128) (2.794) (0.102) (4.750) (0.45777)-0(322.1590).80(20.7940).3(220.2860).00(65.6040).37(15.5705.)03(02.8809.)20(04060.4.10800) --0.220 0.720 0.070 0.04
77-032 0.800 0.320 0.005 0.375 0.032 0.200 0.180 0.220 0.720 0.070 0.040 1.468 4
         (20.320) (8.128) (0.127) (9.525) (0.813) (5.080) (4.572) (5.588) (18.288) (1.778) (1.016) (37.287) --   77-076 0.600 0.220 0.005 N/A N/A 0.14(200.302.01)8(08.1208.1)4(00.1207.5) 2(09.5205.0) 7(0.8103.)02(50.080)0.(344.5072) (51.588) (18.288) (1.778) (1.01
                                                                                                                         (15.240) (5.588) (0.127) -- --77-0(33.55560).3(140.5720).1(32.05560).0(1033.2080.)2(510.7780).0(200.5080).090(8.603.61)15 --0.095 0.250 0.040 0.01
77-035 0.310 0.120 0.003 0.250 0.020 0.090 0.115 0.095 0.250 0.040 0.015 0.480 2
          (7.874) (3.048) (0.076) (6.350) (0.508) (2.286) (2.921) (2.413) (6.350) (1.016) (0.381) (12.192) --    77-087 0.563 0.110 0.003 0.187 0.018 0.08(57.8704.)11(03.0408.)09(0.0706.)26(60.3500.)04(0.5008.)0(220.286)1.(29.9121) (27.413) (6.350) (1.016) (0.381
                                                                                                                         (14.300) (2.794) (0.076) (4.750) (0.45777)-0(326.1590).31(20.7940).1(220.2860).00(63.6004.)25(10.0106.)02(00.5008.)090(32.07.9111)5 --0.095 0.250 0.040 0.01
77-036 0.310 0.120 0.003 0.250 0.020 0.090 0.115 0.095 0.250 0.040 0.015 0.980 4
          (7.874) (3.048) (0.076) (6.350) (0.508) (2.286) (2.921) (2.413) (6.350) (1.016) (0.381) (24.892) --    77-088 0.563 0.110 0.003 0.187 0.018 0.08(57.8704.)11(03.0408.)09(0.0706.)26(60.3500.)04(0.5008.)0(220.286)1.(427.9821) (28.413) (6.350) (1.016) (0.381
                                                                                                                         (14.300) (2.794) (0.076) (4.750) (0.45777)-0(327.1590).31(20.7940).1(220.2860).00(63.6004.)25(10.0106.)02(00.5008.)090(37.05.4111)5 --0.095 0.250 0.040 0.01
77-037 0.310 0.120 0.003 0.250 0.020 0.090 0.115 0.095 0.250 0.040 0.015 1.480 6
          (7.874) (3.048) (0.076) (6.350) (0.508) (2.286) (2.921) (2.413) (6.350) (1.016) (0.381) (37.592) --    77-089 0.600 0.220 0.005 0.282 0.032 0.14(70.8704.)18(03.0408.)14(0.0706.)52(60.350.)07(00.5080).0(420.286)0(.281.9021) (23.413) (6.350) (1.016) (0.381
                                                                                                                         (15.240) (5.588) (0.127) (7.163) (0.81737)-0(338.5560).31(40.5720).1(230.5560).0(0133.2008.2) 5(10.7708.)02(10.0106.0) 90(20.05.7141)5 0--.095 0.250 0.040 0.01
77-038 0.310 0.120 0.003 0.250 0.020 0.090 0.115 0.095 0.250 0.040 0.015 1.980 8
          (7.874) (3.048) (0.076) (6.350) (0.508) (2.286) (2.921) (2.413) (6.350) (1.016) (0.381) (50.292) --    77-094 0.358 0.128 0.003 0.202 0.018 0.11(07.8704.)10(03.0408.)11(50.0706.)30(60.3500.)03(0.5008.)0(320.286)0.(328.9921) (22.413) (6.350) (1.016) (0.381
                                                                                                                          (9.093) (3.251) (0.076) (5.131) (0.45777)-0(329.7940).28(02.540) .1(120.9210).00(72.620N) /A(0.762N)/A(0.7602.0)75(9.08.8111)0 0--.090 0.220 0.040 0.030
77-039 0.280 0.110 0.002 N/A N/A 0.075 0.110 0.090 0.220 0.040 0.030 0.169 1
          (7.112) (2.794) (0.051) -- -- (1.905) (2.794) (2.286) (5.588) (1.016) (0.762) (4.293) --               77-096 0.600 0.220 0.005 0.282 0.032 0.14(07.1102.)18(02.7904.)09(50.0501.)520--0.040-- 0.0(14.0905) 1(.20.97694) (2.4286) (5.588) (1.016) (0.762
                                                                                                                         (15.240) (5.588) (0.127) (7.163) (0.81737)-0(430.5560).28(40.5720).1(120.4130).0(0123.2008.1) 8(17.0106.)01(18.0106.0) 75(27.08.3181)0 0--.090 0.220 0.040 0.03
77-040 0.280 0.110 0.002 0.187 0.018 0.075 0.110 0.090 0.220 0.040 0.030 0.356 2
          (7.112) (2.794) (0.051) (4.750) (0.457) (1.905) (2.794) (2.286) (5.588) (1.016) (0.762) (9.042) --     77-097 0.600 0.220 0.005 0.375 0.032 0.14(07.1102.)18(02.7904.)14(0.0501.)52(40.7500.)07(0.4507.)0(410.905)16(.20.07094) (24.3286) (5.588) (1.016) (0.762
                                                                                                                         (15.240) (5.588) (0.127) (9.525) (0.81737)-0(431.5560).28(40.5720).1(130.5560).0(0123.2008.1) 8(17.7708.)01(18.0106.0) 75(4060.4.10100) 0--.090 0.220 0.040 0.03
77-041 0.280 0.110 0.002 0.187 0.018 0.075 0.110 0.090 0.220 0.040 0.030 0.543 3
          (7.112) (2.794) (0.051) (4.750) (0.457) (1.905) (2.794) (2.286) (5.588) (1.016) (0.762) (13.792) --    77-099 0.600 0.220 0.005 0.282 0.032 0.14(07.1102.1) 8(02.7904.1)4(00.0501.5) 2(04.7500.0) 7(0.4507.)04(10.905)1.(327.7894) (25.286) (5.588) (1.016) (0.762
                                                                                                                         (15.240) (5.588) (0.127) (7.163) (0.81737)-0(432.5560).28(40.5720).1(130.5560).0(0123.2008.1) 8(17.7708.)01(18.0106.0) 75(35.00.0111)0 0--.090 0.220 0.040 0.03
77-042 0.280 0.110 0.002 0.187 0.018 0.075 0.110 0.090 0.220 0.040 0.030 0.730 4
          (7.112) (2.794) (0.051) (4.750) (0.457) (1.905) (2.794) (2.286) (5.588) (1.016) (0.762) (18.542) --    77-100 0.600 0.220 0.005 0.375 0.032 0.14(07.1102.)18(02.7904.)14(0.0501.)52(40.7500.)07(0.4507.)0(410.905)1.(626.7094) (26.286) (5.588) (1.016) (0.762
                                                                                                                         (15.240) (5.588) (0.127) (9.525) (0.81737)-0(434.5560).32(40.5720).1(130.5560).0(0143.2008.1) 8(17.7708.)01(18.0106.0) 85(42.01.6141)0 0--.090 0.260 0.040 0.02
77-044 0.320 0.110 0.004 0.187 0.018 0.085 0.110 0.090 0.260 0.040 0.020 1.104 6
          (8.128) (2.794) (0.102) (4.750) (0.457) (2.159) (2.794) (2.286) (6.604) (1.016) (0.508) (28.042) --    77-101 0.600 0.220 0.005 0.375 0.032 0.14(08.1208.)18(02.7904.)14(0.1002.)52(40.7500.)07(0.4507.)0(420.159)1.(924.7294) (27.286) (6.604) (1.016) (0.508
                                                                                                                         (15.240) (5.588) (0.127) (9.525) (0.8*13M) a(3y.v5a5r6y)de(4p.e5n7d2i)ng(3u.p5o5n6)ap(1p3li.c2a0ti8o)n(.1.778) (1.016) (49.327) --
* May vary depending upon application.
                                                                                                                                                                  All dimensions shown are in inches (millimeters) unless otherwise specified.

All dime2ns0ions shown are in inches (millimeters) unless otherwise specified.

www.lairdtech.com
EMI ESSENTIALS

FINGERSTOCK
D UA L S L OT S E R I E S Part No. 77-075, 77-093, 77-110
                                                   TOP VIEW                                             DUAL SLOT SERIES DIMENSIONS

                                                                                                        SERIES A     B   C                                                D  E H MN                                         OP  Q LENGTH # OF

                Approx. Length                                                                                                                                         PITCH SLOT                                               APPROX. FING.

                                                                                                        Du77a-0l75slo0.t32m5 o0u.10n0t 0p.0a03rts0.a18r7e a0.v01a8ila0.0b8l5e 0f.o11r0 a0.v09a0rie0.t26y0 o0f.0s40lot0t.0e2d0 16.000 86

                                                                                                        applica(t8.i2o55n) s(.2T.5h4)e(0d.07u6)a(l4.s75lo0)t(0f.e45a7)tu(2.r1e59)o(2p.7t9i4m) (2i.z2e86s) (t6h.60e4)c(1o.0m16)p(r0e.5s08s)i(o40n6.400) --
                                                                                                        fo7r7c-e093a(n08..d322555p) r(03o..15v4506id) (e00..s000736a)  good operating range. 0.187 0.018 0.085 0.110 0.090  T(60h..62i06s40)p(10r..0o014d60)u(00c..50t0280is) (4i10d66.e.0400a00l)  86
                                                                                    D                                                                                                                                                                                                               --
                                                                                                                                                                       (4.750) (0.457) (2.159) (2.794) (2.286)
                                                                                    E
                                                                                                        Part No. 77-075, 7f7o-07r79-b131o,0t7h07.3-s125h1i0e0.l1d25ing0.0a03nd0.1g87rou0.n01d8 in0.g085ap0.p11l0ica0.t0i9o0 n0s..26T0he0.0b40i-d0.i0r2e0ct1i6o.0n00al 86
                                                                                                        wiping(8a.2n55d) (c3.o17m5) p(0.r0e76s)s(i4o.7n50)a(c0.t4i5o7)n(2.a15c9)c(o2.m794m) (2o.2d86a) t(6e.6s04a) (1w.01i6d) e(0.v50a8r) i(e40t6y.400) --

                                                                                                        of designs. Ideal for use in the grounding and shieldDinUgALofSLfrOoTnStERIES DIMENSIONS
                                                                                                        panel handleTOs,PsVuIEbWrack assemblies, plug-in units, baScEkRIESplaAnes B C D E H M N O P

                                                                                                        and other eApleprcoxt.rLoenngtihc enclosure applications.                                                                                                    PITCH SLOT
                                                                                                                                                                                                                                77-075 0.325 0.100 0.003 0.187 0.018 0.085 0.110 0.090 0.260 0.040

Part No. 77-075, 77-093, 77-110                                                                                                                                                                                                 (8.255) (2.54) (0.076) (4.750) (0.457) (2.159) (2.794) (2.286) (6.604) (1.016)

                  TOPRVIGIEHWT VIEW                                                                                                                            D                                                                77-093 0.325 0.140 0.003 0.187 0.018 0.085 0.110 0.090 0.260 0.040
                                                                                                                                                                                                                                         (8.255) (3.556) (0.076) (4.750) (0.457) (2.159) (2.794) (2.286) (6.604) (1.016)
                Approx. Length                                                                          DUAL SLOT SERIES DIMENSIEONS
                           B                                                                                                                                                                                                    77-110 0.325 0.125 0.003 0.187 0.018 0.085 0.110 0.090 0.260 0.040

                                                                                                        SERIES A     BC                                                D     E H MN     OP                                      Q LE(N8G.2T5H5) #(3O.1F75) (0.076) (4.750) (0.457) (2.159) (2.794) (2.286) (6.604) (1.016)

                                                                                                                                                                       PITCH SLOT                                               APPROX. FING.

                                                                                                        77-075 0.325 0.100 0.003 0.187 0.018 0.085 0.110 0.090 0.260 0.040 0.020 16.000 86

                                                                                                        (8.255) (2.54) (0.076) (4.750) (0.457) (2.159) (2.794) (2.286) (6.604) (1.016) (0.508) (406.400) --

Part No. 77-075, 77-093, 77-110                                D                                        77-093 0.325 0.140 0.003 0.187 0.018 0.085 0.110 0.090 0.260 0.040 0.020 16.000 86
                                                      M        E                                                 (8.255) (3.556) (0.076) (4.750) (0.457) (2.159) (2.794) (2.286) (6.604) (1.016) (0.508) (406.400) --

                                                                      A                                 77-110 0.325 0.125 0.003 0.187 0.018 0.085 0.110 0.090 0.260 0.040 0.020 16.000 86
                                                                                                                 (8.255) (3.175) (0.076) (4.750) (0.457) (2.159) (2.794) (2.286) (6.604) (1.016) (0.508) (406.400) --

                C TOP VIEW                                                                              DUAL SLOT SERIES DIMENSIONS
                                                                                                                        RIGHT VIEW

                                                                                                        SERIES A     BC                                                D     E H MN     OP                                      Q LENGTH # OF

                A2pXprQox. Length                                                                                           PITCH SLOT                                                                                          APPROX. FING.

                                                            H                                           77-075 0.325 0.100 0.003 0.187 0.018 0.085 0.110 0.090 0.260 0.040 0.020 16.000 86
                                                                                                                 (8.255) (2.54) B(0.076) (4.750) (0.457) (2.159) (2.794) (2.286) (6.604) (1.016) (0.508) (406.400) --

                                                                                 D                      77-093 0.325 0.140 0.003 0.187 0.018 0.085 0.110 0.090 0.260 0.040 0.020 16.000 86
                                                                                                                 (8.255) (3.556) (0.076) (4.750) (0.457) (2.159) (2.794) (2.286) (6.604) (1.016) (0.508) (406.400) --
                                                                                 E
                                                                                                        77-110 0.325 0.125 0.003 0.187 0.018 0.085 0.110 0.090 0.260 0.040 0.020 16.000 86
                                                         RIGHT VIEW                                              (8M.255) (3.175) (0.076) (4.750) (0.4A57) (2.159) (2.794) (2.286) (6.604) (1.016) (0.508) (406.400) --

                                                         B                                                        C

                                                                                                                  2X Q                                                 H

                                                     M
                                                                                                     A

All dimensions shown are in inches (millimeterCs) unleRssIGotHheTrwVisIeEWspecified.

                2X Q B                                      H

TEARDRM OP SEARIES

                                                              C

Teardrop slot fingerstock gaskets include a shaped cAull dtimdenesivoneslsohopwen daretinoinochpest(immillimaeltleyrs)dunisletssriobthuerwteisetshpeecifiemd. echanical stresses when the part is
compressed, and to avoid e2XxcQessive inHsertion forces on a stack of rack mounted modules. Please contact a Laird technical resource
to review current applications that might benefit from incorporating this feature into existing gaskets where minimal insertion force
is desired. Patent # 7,112,740

All dimensions shown are in inches (millimeters) unless otherwise specified.

All dimensions shown are in inches (millimeters) unless otherwise specified.                                                                                                 0097-0988

                 0097-0987

                                                                                                                                                                          21

www.lairdtech.com
                            EMI ESSENTIALS

                            FINGERSTOCK

C O M PA C T P C I S Y M M E T R I C A L M O U N T Laird Technologies offers a unique product designed to shield the front panels

ofLIaEiErdETsetachnndoalrodg1ie1s0o1f.f1e0rscaarudnciqaugeesp,rcoodmucmtodnelsyigrenfeedrretod sthoiealsdDthoet-1fr0o,nctapllaendels

LairtdhLoTeaefiCrcIdEhoEnTmEeopclsohatgncationePldsoCagorIidfegfse1aros1skf0faee1tru.s1n0aiqcuaneridqpurcoeadgpuercsot,dcduoecmstimdgenosenidglynteoredsfehtorireeslddhitteholdeatfshroDenoftrto-p1na0tn,pecalasnlloeeflds
IEEEThostifthsaeIEnfrECdoEaonrmtsdtppa1aan1cnd0tea1Plrd.Cs1hI10ige1cal0das1irknd.e1gtc0.hacgaasersdb, eceoangmedmse,oscnioglmynermedofetnorlryesdhreietfeoldrraebsdeDttwote-ae1sn0D,tohctae-l1lfe0rdo, nctthaleled

CompptaThanheceitslCsPforoCmonInpgtsaaupcsbtaknPeraeCt.clIksgshaiasenkldeditn.pgluhga-sinbueneints.dTehsigsniseda tboersyhlileiuldmbceotpwpeeernsothlied ftroopnt

ThissyfTrpmhoainmsntefrpltosrainonctanepl sasulhnobietetlrleadsdchinkifegsinldhagiannesdrgsbpthoelauecskgn-bsdinetereisupningpdintresee.sd-iTpghtlnoaisetsdeihsditeaoilndbshsebuireeyltfllawdliumebmeaenttcewtohnepeeipcnkefrertolhs.neoIttlfpidrisaontnoetpls
on sdupesbasyinmrgaenmcleskedsotrnatiocnsadmulbpsoluorantgctt-ekiodnsnaufintnhdigteesp."rlTsuTthg"ois-csiknihsasuatpnreibiptesopr.nyTrlehlai-uipsfmrliaostnceaotdpbppieanernyrseluslliolueflamxidmtrcutaoostppeiopsneyircm(sksemoell.eidbtItreitcilosoapwl ).
slotStespdyeemcfsiminaglgelnyeterrdiscetaotsolcigskmnloseottdtrueipnfdotprforinweng-iptehliranesttge"odTack"pinpsslthsircuaiaplpftaeipomroneans-,tpeatlahnftirsiecodkcneotinln.pfIsaitguniulsefraladmetixsoatintgreunasnelilodiocnkwtoe(sls.metIoetotuibasnletloown).
the s"ydTSme"psmeisgcheinaterplildcyeatdoloencsomaimgonfpureorndentstfosopinorantwnheaieplcie"tnixTogt"nrauswpshipioatlhnpiceab(stioe-iondenirabse,ecftlrtohoiowinsnt)ac.polSanepnnfeiegcliauaegrlxaleyttmriduoesnnisoiatgn.llno(eswdesefotboretwaloliwpi)n.g
appSlitScsapaynetmdicoaminardsell,ytsrtizihdceieasslhcicgooonwnmefnidpgirusfeorbsarsatwisoeindpiaoncnlgltoitoahwpnesp9wtl.io5cita"hatli(bo2sin4y-ms1d,.im3rteh0eci0st)iroiclcenoananlglfctieghonumpgreapartrgietohesnemsiDoaenlolotta-.w1c0tsiosttonatnwadliathrd.                                                                                                                                                                                                         77-077
bi-dOirsteSyhtcmaetnrimodlneeanatrdrglicteshanizslgecaasonghmdeomwprlneaentsiistsn.ibgoanfsienadicsthoioensnthawerei9tha.5vb"ai-(la2db4irl1e.c3fto0ior0n)yaolelunergnstpgheapcgeiefrimcthaeepnDpt.loict-a1t0ionst.andard.                                                                                                                                                                                                                                                    77-077
                                                                                                                                                                                                                                                                                                                                                                                                                                                                             77-077
StandSOatatrnhddesarirzldeenssgizhtehosswhanonwidsnpbilsaasbteiandsgeodfninoitnshhteehse9.a95r.e"5"a(2v(2a4i41la1.3b.3l0e000f)o)lrleeynnogguttrhhspppeerrctithfhieceDaDpoopt-tl1i-c10a0tsitosantna.dnadrda.rd.
OtheOr tlehnegr tlehnsgatnhds apnladtipnlgatfiningisfhineisshaerseRaaIrGveaHaiTlvaVabIilEleaWbfloerfyooruyrosuprescpieficcifaicpapplipcalictiaotnio.n.                                                                                                                                                                                                                                                                                                            TOP VIEW
                                         RIGHT VIEW                                                                                                                                                                                                                                                                                                                                                                                                                 TOP VIEW
                                                                                                                                                                                                                                                                                                                                                                                                                                                                   TOP VIEW
                                                           0.191

                                         RIGHT     VIEW    (4.851)
                                                               0.191

                                                             (4.851)

                                         52.5             0.191                                                                                                                                                                                                                                                                                                                                                                                                  16.000 (406.400) Length
                                            52.5          (4.851)                                                                                                                                                                                                                                                                                                                                                                                                   16.000 (406.400) Length

                                                   R. 0.050                        H                 0.0025                                                                                                                                                                                                                                                                                                                                                         16.000 (406.400) Length   Pitch 0.250 (6.350)
                                                                                                     (0.063)
                0.050                    52.5     (1.270)                            H                                                                                                                                                                                                                                                                                                                                                                                                        SlPoitc0h.001.285(00.(465.375) 0)
                (1.270)                              R. 0.050                 27.0 0.012               0.0025
    0.065                                                                                               (0.063)                                                                                                                                                                                                                                                                                                                                                                                    Slot 0.018 (0.457)
    (1.651)         0.050                                  (1.270)                   H (0.305)                                                                                                                                                                                                                                                                                                                                                                                                  Pitch 0.250 (6.350)
                   (1.270)                                                       27.0 0.012           0.0025
        0.065               0.026                                                                      (0.063)                                                                                                                                                                                                                                                                                                                                                                                   Slot 0.018 (0.457)
       (1.651)     0.050                                                                    (0.305)
                  (1.270)   (0.660)                R. 0.050                     27.0 0.012
       0.065                                       (1.270)
      (1.651)               0.026        0.190                                             (0.305)
                            (0.660)      (4.826)                                                                                                                                                                                                                                                                                                                                                                                                                  Dimples on 1.500 (38.100) Centers
                                                                                                                                                                                                                                                                                                                                                                                                                                                                            Randomly Located
                            0.026                 0.190
                            (0.660)               (4.826)                                                                                                                                                                                                                                                                                                                                                                                                            Dimples on 1.500 (38.100) Centers
                                                                                                                                                                                                                                                                                                                                                                                                                                                                               Randomly Located

                            2X 0.053            0.190 0.085 REF.                                                                                                                                                                                                       Approximate number of fingers is 64.                                                                                                                                                       Dimples on 1.500 (38.100) Centers
                             (1.346)            (4.826) (2.159)                                                                                                                                                                                                           Approximate number of fingers is 64.                                                                                                                                                              Randomly Located

                               2X 0.053                       0.085 REF.
                                (1.346)                         (2.159)

                            2X 0.053                       0.085 REF.                                                                                                                                                                                                  Approximate number of fingers is 64.
                             (1.346)                         (2.159)

           ALTERNATE SLOT SERIES

   Laird Technologies alternating slot/cut design is designed for use in a wide
LairvdaLTraeieicrthdynTooeflcoshglonietotsleodagltiaepsrpnalailctieanrtgnioasntlsion,tg/scuuscltohdta/ecssuiftgrnodneist ipdgaennsiesglndheeadsnigfdonlreesud,spfeoluirngu-asinewuiindneiatsvw,airdieety
oasfssesTlomuhLvvstaabeuabtrirerbrliaaieddierecltatsktTyaec,yepkraocconphsfhafalsainssectsslsoiaolmsnoelttiogmstibtoteglecbnisdieodellsosivs,ae,atespsacpru,/phlsptccclaeilahhucisrcnatansadstiadsstisoitebioficsnnsranooiscggsv,nok,ensstvpsrlueposulsacreatcahsn/hrncnevaaeudaesnlst.ssdhbdfftraaebroncosankdinecgtpltnkenplpahpsai,lnaasanpennnedlsecuel.eelgshsh.-iatgiahnnnnedeudldgneleasifst,sos,pk,rpelsuluutgsbgse-rt-iarniinencnukuangnitwtihtssi,d, e
AvawilsaThubhiblleerapaicnrlktoeavariswndsaiiendtmgienbgevlaniesroliseou,ttgcyh/oacffuslesptxilsdaibetciioslniivtggyenfrtisonsaieasnrhlvldeoeswsbtatotcohkmeepenlpaehantaretgnsatc.olevabtnheiecfogclodameskdpeaitntsibhtrialeiltfnygwtihth,
rAevqaunoiliTworarwnhebrhorheemleieplirseleaeeauinlnsiptlrptute.rsaUrlor.tonnlvatvtainrdiadfttiiiSninnfnoigggngfetgesTMreenlnodroo,taudulm/ogagcwmhahugaftceflgelod.eexmTex.ihbsiTpbiiihsgrliileintiistsysyssiteisetoosorenpvasaeeslpllcesoleiorawctiweiolalsytltehl(hysn-eie0ghsp7inapga8inanfr)irctic.tfeaitctonotathnbbeiteneigfndfoaouldsdlrdkuieneerdigtdnisginntrishenhtanasatlglflafatlwhltwai,iottitihnohn

   Anvooarilrraeebspulaelitria.nntafwinigdervdaarmietaygoe.f Tphlaistiinsgesfipneischiaelslytosigmneifeictagnatlvinandiucrcinogmipnastiablillaittyion
   reoAqruvraierieplamabierl.entisn. a wide variety of plating finishes to meet galvanic compatibility
   AAvreavqailaiulabirbleelmeineinnUtaslt.rwaSidoeftvTMa,rlioewty coofmplparteinssgiofinnissehreiessto(-0m7e8e)t. galvanic compatibility
    rAeqvauilraebmleenints.UltraSoftTM, low compression series (-078).

Available in UltraSoftTM, low compression series (-078).                                                                                                                                                                                                                                                                                                                                                                                                                                                                          77-098
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    77-098
                                          RIGHT VIEW
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   77-098
                            RIGHT VIEW                       2X 0.085
                            RIGHT VIEW                        (2.159)

                                                                2X 0.085
                                                                 (2.159)

                                                                    2X 0.085
                                                                     (2.159)

                                                                                                                                                                                                                                                                                                                                                                                                                                                                  TOP VIEW

                R 0.020                                      R 0.110                                                                                                                                                                                                                                                                                                                                                                                              TOP VIEW                                                        0.218 TYP
                (0.508)                                      (2.794)                                                                                                                                                                                                                                                                                                                                                                                              TOP VIEW 0.018 (0.457) Slot                                       (5.537)
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     0.218 TYP
                   R 0.020                                      R 0.110                                                                                                                                                                                                                                                                                                                                                                                                                    0.018 (0.457) Slot                          (5.537)
                   (0.508)                                      (2.794)
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         0.018 (0.457) Slot                         0.218 T0Y.3P20
                  R 0.020                                      R 0.110                                                                                                                                                                                                                                                                                                                                                                                                                                                                (5.53(87.)128)
                  (0.508)                                      (2.794)                                                                                                                                                                                                                                                                                                                                                                                                                                                                         0.320
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              (8.128)

                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        0.374 (9.500)             0.320
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        Pitch                     (8.128)

                                                                                                                                                                                                                                                                                                                                                                                                                                                                  14.568 (370.027) Length                  0.374 (9.500)
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           Pitch

                            0.110                                                                                                                                                                                                                                                                                                                                                                                                                                 14.568 (370.027) Length               0.374 (9.500)
                            (2.794)                                                                                                                                                                                                                                                                                                                                                                                                                                                                     Pitch
22
                                         0.110                                                                                                                                                                                                                                                                                                                                                                                                                    14.568 (370.027) Length

                                         (2.794)

All dimensions shown are in inches (millimeters) u(n02le..17s19s04o)therwise specified.

www.lairdtech.com All dimensions shown are in inches (millimeters) unless otherwise specified.

All dimensions shown are in inches (millimeters) unless otherwise specified.
        EMI ESSENTIALS

        FINGERSTOCK
        VARIABLE SLOT MOUNT

                                                                                               77-057                                                                    Laird Technologies introduces Variable Slot Mount shielding,
                                                                                                                                                                         which eliminates the use of long slots while still utilizing the easy

                                                                                                                                                                         installation method of slot mount shielding. Fingers are removed
                                                                                                                                                                         from the strip in areas where a mounting slot is not present.

                                                                                                                                                                         The Variable Slot Mount shielding strips can be customized to any
                                                                                                                                                                         patterned series of slots.

                                                                                                77-057                                                                   Easy and cost-effective installation since fasteners and adhesives
                                                                                               77-066                                                                       are not required

                                                                                                                                                                         Improved shielding effectiveness compared to traditional slot

                                                                                                                                                                            mount series through elimination of long slots in host material

                                                                                                                                                                         Slot mounting feature can be varied to accommodate different

                                                                                                                                                                            lengths and hole mounting patterns (see figure 2)

                                                                                                                                                                         Three and five pitch segments ideal for grounding applications

                                                                                               77-7076-0066                                                               Bi-directional wiping and compression action to accommodate a
                                                                                                                                                                            wide variety of designs

                                                                                                                                                                         Available in standard (77-Series) and UltraSoft (78-Series low
                                                                                                                                                                            compression versions)

                                                                                                                                                                         Ability to retrofit equipment when higher clock speeds limit current

                                                    77-056                                     77-060                                                                       slot mount product without changing slot size or location
FIGURE 1: REPEATING FINGER PATTERN
                                                                                                                                                                         One piece construction eliminates handling individual pieces,

                                                                                                                                                                            thereby shortening installation time

                                                                                                                                                                         Ideal for grounding and shielding in the following electronic

A Repeating Finger Pattern for 77-056 and 77-057 D Rep7e7a-ti0n5g6Finger Pattern for 77-106                                                                                 enclosure applications:
       FIGURE 1: REPEATING FINGER PATTERN
                                                                                                                                                                            Front panel hPaarnt dNloe:s77C-5o6m-0Cp2rhe(Vassasirosiainsb/DlceeoSfvlleoectrtsiMonount Series)Backplanes

                                                                                                                                                                            P50lug-in units                         Subrack assemblies

                                                                                                                                                                                                                                                                                                                                                70

                                                                                                                                                                            45
                                                                                                                                                                            L oad (poundLsopaedr (lipnoeuarnfdosotp)er linear foot)
        A D Repeating Finger Pattern for 77-056 and 77-057  Repeating Finger Pattern for 77-106                                                                                                                                                                                                  L oad (kilograms -forc e per linear meter)          60

                                                                                                                                                                                                                                                                                                  L oad (kilograms -forc e per linear meter)70 50
B E Repeating Finger Pattern for 77-090 and 77-061         Repeating Finger Pattern for 77-060 and 77-107                                                                    40                         Compression/Deflection                                                                                                              60 40
                                                                                                                                                                                         Part No: 77-56-02 (Variable Slot Mount Series)                                                                                                     50 30
                                                                                                                                                                            5305                                                                                                                                                            40 20
                                                                                                                                                                                                                                                     77-056                                                                                 30 10
                                                                                                                                                                            4350                                                                                                                                                            20
        B E Repeating Finger Pattern for 77-090 and 77-061  Repeating Finger Pattern for 77-060 and 77-107
                                                                                                                                                                            4205                                                                                                                                                                     0
C Repeating Finger Pattern for 77-105, and 77-066            Full Semi                                                                                                      3250                                                                77-056                                                                                            80
                                                            Finger Finger                                                                                                   30                                                                         78-056                                                                               10
                                                                                                                                                                             15
        C Repeating Finger Pattern for 77-105, and 77-066    Full Semi                                                                                                      25                                                                  78-056
                                                            Finger Finger                                                                                                    10
                                                                                                                                                                            20
                                                                                                                                                                                                   20                          40                   60
                                                                                                                                                                              5
                                                                                                                                                                            15                                                Deflection (%)

                                                                                                                                                                              0
                                                                                                                                                                            10 0

                                                                                                                                                                             5

                                                                                                                                                                            0                                                                                     0
                                                                                                                                                                                                                                                               80 *N
             FRONT VIEW                                                                                                                                                  RIGHT V0IEW           20                    FIG40URE 2                 60

        Approx. Length                                                                                                                                                                                               Deflection (%)

                    FRONT VIEW                                                                                                                                           B

                 Approx. Length                                                                                                                                          RIGHT VIEW      H                           FIGURE 2                                  *N                                                                                        *O
                                                                              A
                                                                                                                                                                         B

                                                                                                                                                                                      H                                                                                                                                                     *O

                                                                                            A                                                                                                                                                           Length of slot and distance
                                                           E Slot

                                                                                                             C                                                                              M                                                           between slots is dependent
                                                                                                                                                                                                                                                        on hole mounting pattern.
                                                                                                                                                                                                                          *P
        D Pitch                                                                                                                                                             Q
                                                            E Slot
                                                                                                                                                                                                                            Material Thickness      Length of slot and distance
                                                                                                             C                                                                           M                           *P                             between slots is dependent
                                                                                                                                                                                                                                                    on hole mounting pattern.

VARIABLE SLOT MOUNT DIMEDNPSitIcOh NS                                                                                                                                       Q

                                                                                                                                                                                                                     Material Thickness

SERIES VAARIABBLE SLOC T MODUNT EDIMENH SIONMS *N *O *P Q LENGTH # OF SERIES A                                                                                                        B        C                  D  E H M *N *O *P Q LENGTH # OF

VIEW**                                                      RECOMMENDED (R) APPROX. FING. VIEW**                                                                                                                                                RECOMMENDED (R) APPROX. FING.

77-056 0S.E3R2IE0S 0.A110 0B.004 0C.187 D0.018 E0.085 H 0.110M 0.09*0N 0.26*0O 0.04*0P 0.02Q0 L1E6N.0G0T0H #8O6F                                                         S7E7R-I0ES90 0A.600 B0.220 C0.005 D 0.282E 0.03H2 0.14M0 0.1*8N0 0.1*4O0 0.*5P20 0.Q070 L0E.N0G40TH #16O.0F00 57
   A (8V.I1E2W8*)* (2.794) (0.102) (4.750) (0.457) (2.159) (2.794) (2.286) R(E6C.6O0M4M) E(N1.D0E1D6) (0.50(R8)) (4A0P6P.4R0O0X). F--ING.                                VIEWB** (15.240) (5.588) (0.127) (7.163) (0.813) (3.556) (4.572R)E(C3O.5M5M6)EN(1D3E.D208) (1.(7R7)8) (A1P.0P1R6O)X.(4F0IN6.G4.00) --
           77-056 0.320 0.110 0.004 0.187 0.018 0.085 0.110 0.090 0.260 0.040 0.020 16.000 86                                                                            77-090 0.600 0.220 0.005 0.282 0.032 0.140 0.180 0.140 0.520 0.070 0.040 16.000 57
                                                                                                                                                                         77B-105(150.2.6400)0(5.508.28)20(0.1027.0)0(57.1603.)28(02.8130).0(33.25560) .1(44.0572)0.(138.5056) 0(1.134.2008) 0(1..572708) (01..001760) (400.064.4000) 1--6.000 57
77-057 0.6A00 (80..122280) (20..709045) (00.1.0228)2 (4.07.5003)2(0.405.17)30(2.1509.1) 8(02.7904.)14(20.2860).5(26.06040) .0(17.0016)0(.00.45008) (1460.60.04000) 5--7
   A (15.240) (5.588) (0.127) (7.163) (0.813) (3.302) (4.572) (3.556) (13.208) (1.778) (1.016) (406.400) --                                                                 C (15.240) (5.588) (0.127) (7.163) (0.813) ( 3.556) (4.572) (3.556) (13.208) (1.778) (1.016) (406.400) --
           77-057 0.600 0.220 0.005 0.282 0.032 0.130 0.180 0.140 0.520 0.070 0.040 16.000 57                                                                            77-105 0.600 0.220 0.005 0.282 0.032 0.140 0.180 0.140 0.520 0.070 0.040 16.000 57

77-060 0.3A20 (105..12140) (50..508083) (00.1.2178)7 (7.01.6031)8(0.801.03)85(3.3002.1) 1(04.5702.)0(930.5560).(21630.2080).(014.7078)0(.10.20016) (1460.60.0400) --86      77C-106(150.2.640)0(5.508.82)20(0.1207.0)0(57.1603.)28(02.8130).0( 32.5560).1(44.0572)0.(138.5056) 0(1.134.2008) 0(1..572708) (01.01760) (400.064.4000) 1--6.000 57

E (87.71-2086)0 (20..739240) (00..101706) (04.0.70530) 0(0.1.84757)0(.201.1859)0.0(28.57940).1(120.2860.)09(06.6004.2)6(01.001.60)40(0.500.082)0 (40166.4.00000) --86 77-1D06 (01.560.2040)0(.252.5088)0.(000.51270).2(872.1603.)03(02.8103.1)4(03.505.61)80(4.507.124)0(3.505.562)0(130..200780) (10..707480) (11.06.1060)0 (40567.400) --

77-061 0.3E20 (80..112180) (20.7.09043) (0.00.7168)7(4.705.001) 8(0.405.70)85(2.1509.)11(20.7940).0(920.2860) .2(66.0604)0.(014.0016) 0(.00.25008) (14606.0.40000) --86     77D-107(150.2.6400)0(5.508.28)20(0.1027.0)0(57.1603.)28(02.8130).0( 332.5560).1(44.0572)0.(138.5056) 0(1.134.2008) 0(1.5.72708) (01..001760) (400.064.4000) 1--6.000 57

B (87.71-2086)1 (20..739240) (00..101706) (04.0.70530) 0(0.1.84757)0(.201.1859)0.0(28.57940).1(120.2860.)09(06.6004.2)6(01.001.60)40(0.500.082)0 (40166.4.00000) --86 77-1E07 (01.560.2040)0(.252.5088)0.(000.51270).2(872.1603.)03(02.8103.1)4(03.505.61)80(4.507.124)0(3.505.562)0(130..200780) (10..707480) (11.06.1060)0 (40567.400) --

77-066 0.3B20 (80..112180) (20.7.09043) (0.00.7168)7(4.705.001) 8(0.405.70)85(2.1509.)11(20.7940).0(920.2860) .2(66.0604)0.(014.0016) 0(.00.25008) (14606.0.40000) --86     * E Ma(1y5v.2a4ry0)d(e5p.5e8n8d)in(g0.1u2p7o)n(7a.p1p6l3ic)a(t0io.8n1.3) ( 3.556) (4.572) (3.556) (13.208) (1.778) (1.016) (406.400) --                                          23
  C (87.17-2086)6 (20..739240) (0.101706) (04.0.70530) 0(0.1.84757)0(.20.11859)0.0(28.57940).1(120.2860.)09(06.6004.2)6(01.001.60)40(0.500.082)0 (40166.4.00000) --86       ***MSaeye vFaigryudrep1enfodrinfginugpeornpaaptptelircnasti.on.

        C (8.128) (2.794) (0.076) (4.750) (0.457) (2.159) (2.794) (2.286) (6.604) (1.016) (0.508) (406.400) --                                                              ** See Figure 1 for finger patterns.

        www.lairdtech.com
            EMI ESSENTIALS

            FINGERSTOCK
            SYMMETRICAL (S3) SLOTTED SHIELDING

                                                                                                                                   RIVET MOUNT

                                                                                                                                                                                              97-952

                                                                                  97-951

                                                                                                                                                                                              97-955

                                                                                  97-954

                                                                                                                                                                                              97-958

                                                                                  97-957

     Strips with Sticky Fingers and Rivet Mounts exhibit                                                 S3 SERIES -- STICKY FINGERS
     typical attenuation >100 dB for a 100 MHz plane wave.
                                                                                                          SERIES     A               B           C              D           E  K                  L     APPROX.
                        WITH STICKY FINGERS                                                               97-951   MIN.                                                                                  LENGTH
                          Series 97-951/954/957 are low compression, adhesive-                            97-954   0.620          0.220        0.004          0.375          0.030 0.760       0.100     15.000
                          mounted beryllium copper shielding strips. Designed as                          97-957  (15.748)        (5.588)     (0.102)        (9.525)        (0.762) (19.304)  (2.540)  (381.000)
                          a continuous band, the strip is slotted to permit spring                                                0.140        0.003          0.250                            0.070
                          contact throughout its length. A wide radius profile creates                             0.450          (3.556)     (0.076)        (6.350)         0.022 0.510      (1.778)    15.000
    the greatest contact for maximum conductivity with minimum compression                                        (11.430)        0.110        0.003          0.187         (0.559) (12.954)   0.055   (381.000)
    requirements. As with all Sticky Fingers shielding strips, a self-adhesive tape                                               (2.794)     (0.076)        (4.750)                          (1.397)
    makes mounting easy and secure. All are available in your choice of finishes,                                  0.350                                                     0.018 0.380                 15.000
    see page 17.                                                                                                  (8.890)                                                   (0.457) (9.652)            (381.000)

                        WITH BI-DIRECTIONAL RIVET MOUNT                                                   S3 SERIES -- RIVET MOUNT
                          Series 97-952/955/958 are as described above, but
                          with the addition of an integral pierced brass track                            SERIES     A        B           C           D      E           K     L APPROX. M             N NO. OF
                          to provide plastic push rivet mounting in a 0.125 in.                           97-952             MIN.
                          (3.175 mm) diameter hole.                                                                0.620    0.220       0.004       0.375                      LENGTH                  RIVETS
                                                                                                                  (15.748)  (5.588)     (0.102)     (9.525)
                                                                                                                                                             0.030 0.760 0.100 15.000 0.560 0.940 10

                                                                                                                                                             (0.762) (19.304) (2.540) (381.000) (14.224) (23.876) --

                                                                                                          97-955 0.450 0.140 0.003 0.250 0.022 0.510 0.070 15.000 0.630 0.880 10
                                                                                                                     (11.430) (3.556) (0.076) (6.350) (0.559) (12.954) (1.778) (381.000) (16.002) (22.352) --

                                                                                                          97-958 0.350 0.110 0.003 0.187 0.018 0.380 0.070 15.000 0.660 0.840 10
                                                                                                                      (8.890) (2.794) (0.076) (4.750) (0.457) (9.652) (1.778) (381.000) (16.764) (21.336) --

    Designed especially for slide applications, this configuration allows total                                             S3                               S3 RIVET MOUNT                   RATCHET TYPE
    symmetrical compression action with bi-directional engagement. It is                                                                                                                          97-944
    recommended for high temperature and/or extremely high side load situations,                                                           D
    such as PC board connections and electronic drawers. All are available in                                                                                                                  STANDARD
    your choice of finishes, see page 17. Both are available in UltraSoft                                                              E                                          D
    low compression force 98-Series.                                                                                                                                                                                0.195
                                                                                                                                                                               E                                   (4.953)
    S3 SERIES                                                                                                                  K                                         K        C
                                                                                                                                                                                       L
                                                                                                                            A                                            A
                                                                                                                                                                                 Smallest
    SERIES     A        B                                                         C           D           B                                      L     B                         Opening

    95-901     0.284       0.030                                                    0.010       0.068            Double           C                          Push Rivet
    95-902     (7.214)    (0.762)                                                    (0.254)     (1.727)        Adhesive
                                                                                                                                           Smallest
               0.325       0.030                                                  0.010       0.080                Tape                    Opening
               (8.255)    (0.762)                                                 (0.254)     (2.032)
                                                                                                                          RIVET SPACING                                     TAPERED TYPE 97-950 OPTIONAL
                        95-901-902                                                                                                                                          97-945 WHITE RIVET AVAILABLE

                                                                                                                            M        N                                           ONLY ON PART # 97-958

                        A
                                                 D
                                                                      C

                                                                    B                                                                                                                                  0.285
                        Optional PSA Tape                                                                                                                                                              (7.239)

                                                                                                           1.500                  CL        1.500
                                                                                                          (38.100)                Slot     (38.100)

24  All dimensions shown are in inches (millimeters) unless otherwise specified.                          2 rivet types are available. Consult sales for more information.

               www.lairdtech.com
EMI ESSENTIALS

FINGERSTOCK
SOLID TOP (S3) SYMMETRICAL SLOTTED
SHIELDING GASKET

Laird Technologies offers their Solid Top Symmetrical Slotted Shielding                                                                                                      97-910
Gaskets. This product is uniquely designed for those applications                                                                                                            97-913
where a lid or cover is closed using a sliding motion to complete
the closure. The solid top design allows the cover to slide either
perpendicularly or parallel to the fingerstock without snagging or
damaging the gasket.

Solid top provides an additional 10 dB of shielding effectiveness                                                                                                          97-915
Offered in both rivet mount and tape mount versions
Available with two types of rivets                                                                                                                                         97-916
Generous radii provide maximum conductivity with minimum
                                                                                                                                                                             97-918
   compression forces
Parts can be modified and/or cut to any specific length                                                                                                                    97-919
For longitudinal sliding applications, a retention clip is
                                                                                    SOLID TOP S3 SERIES - STICKY FINGERS
   recommended for secure mounting
Available in standard or UltraSoft (part numbers beginning with                  SERIES          A             B             C            D           E             K         L         APPROX.
                                                                                    97-910        MIN.                                                                                      LENGTH
   -98) versions                                                                                  0.620         0.220        0.004        0.375       0.030        0.760     0.100        15.000
                                                                                                 (15.748)       (5.588)      (0.102)      (9.525)     (0.762)      (19.304)  (2.540)      (381.000)
                   < View A - Computer tower side                                                                                                     0.022        0.510     0.070
                                                                                    97-915        0.450 0.140                0.003        0.250       (0.559)      (12.954)  (1.,778)     15.000
                                       panel is moved sideways during the                        (11.430) (3.556)            (0.076)      (6.350)     0.018        0.380     0.070        (381.000)
                                       first step of installation.                                                                                    (0.457)      (9.652)   (1.778)
                                                                                    97-918          0.350       0.110        0.003        0.187                                           15.000
                   < View B - Next, the panel is moved                                              (8.890)     (2.794)      (0.076)      (4.750)                                         (381.000)

                                       downwards, sliding longitudinally on         SOLID TOP S3 SERIES - RIVET MOUNT
                                       the vertical finger gasket.
                                                                                    SERIES       A           B     C         D         E           K     L APPROX. M                   N          NO. OF
                                                                                    97-913                                                                                                        RIVETS
                                                                                                 MIN.                                                              LENGTH
                                                                                                                                                                                                    10
                                                                                                 0.620 0.220       0.004 0.375 0.030 0.760 0.100 15.000 0.560 0.940                                 --

                                                                                                 (15.748) (5.588)  (0.102) (9.525) (0.762) (19.304) (2.540) (381.000) (14.224) (23.876)

                                                                                    97-916 0.450 0.140 0.003 0.250 0.022 0.510 0.070 15.000 0.630 0.880 10
                                                                                              (11.430) (3.556) (0.076) (6.350) (0.559) (12.954) (1.778) (381.000) (16.002) (22.352) --

                                                                                    97-919 0.350 0.110 0.003 0.187 0.018 0.380 0.070 15.000 0.660 0.840 10
                                                                                               (8.890) (2.794) (0.076) (4.750) (0.457) (9.652) (1.778) (381.000) (16.764) (21.336)

                                    < View C - Fully installed panel is                     RETENTION CLIP                            PART NO.                     RIVET MOUNT PART NO.
                                                                                                  97-964                                 Used On                                97-919
                                    now compressing both finger gaskets.                          97-965                                 Used On                                97-916
                                                                                                  97-966                                 Used On                                97-913

                                                                                                                   D                                     D

                                                                                                                   E                                     E                                0.195
                                                                                                                                                                                         (4.953)
                                                                                                       A     K                            K                                    Rachet Type
                                                                                                                                                                                 Standard
                                                                                                                                          A
                                                                                                                                                                                        0.285
                            SOLID TOP S3 TRANSFER IMPEDANCE                                   B                                 B                                                      (7.239)

                                                                                    Double                            L         Push                          L              Tapered Type
                                                                                    Adhesive                                                             Smallest               Optional
                  160                                                               Tape                     C     Smallest     Rivet                    Opening
                  140
                  120                                                                                              Opening
                  100
                                                                                                                                                      M        N
                   80
Attenuation (dB)   60                                                                                                                  1.500                        1.500
                   40                                                                                                                 (38.100)                     (38.100)

                   20       97-919
                     0      97-916
                       10K  97-913

                            100K    1M              10M                       100M                                                                                                                 RETENTION CLIP
                                                                                    1G
                                    Frequency (Hz)
                                                                                                                                        The above picture shows our Solid Top S3 with a
All dimensions shown are in inches (millimeters) unless otherwise specified.                                                        retention clip. This clip is designed to ensure secure
                                                                                                                                     retention of actual fingerstock to track component.

                                                                                                                                                                                                                   25

www.lairdtech.com
EMI ESSENTIALS

FINGERSTOCK
CLIP-ON SYMMETRICAL SHIELDING

                                                                                          97-636               The 97-636 and 97-637 Clip-On Symmetrical Shielding Gaskets have
                                                                                                               been designed to function equally well in applications requiring sliding
                                                                                                               movement or direct compression.

                                                                                                                Supplied with standard "D" lance ensuring secure holding power
                                                                                                                  when snapped into a prefabricated hole

                                                                                                                "D" lance provides both multi-directional grip and excellent
                                                                                                                  conductivity

                                                                                                                Wide radius profile allows for maximum contact with minimum
                                                                                                                  compression force

                                                                                                                Clip-On feature allows part to be used in high temperature
                                                                                                                  (above 250F) applications where adhesives will not function

                                                                                                                Available in our UltraSoft, 98-Series low force version

                                                                                                                Ideally suited for cardcage handles, PC board grounding or any
                                                                                                                  other application requiring clip-on feature and wiping action

                                                                                                                Shielding effectiveness of 100 dB @ 100 MHz

                                                                                                                Available in a wide variety of plating finishes, see page 17

                                                                                                       97-637

                                                      97-636                                                                                         97-637

                                                       FRONT VIEW                                                        SECTION A-A                                   COMPRESSION VIEW

                                                   16.150 (86 Fingers)                    0.188 Pitch           0.511                   0.025                                                           0.060
                                                         (410.210)                        (4.775)              (12.979)                 (0.635)                                                        (1.524)
                                                                                                                                                                                                      Smallest
                                                     0.018 Slot                                                                                                                                       Opening
                                                       (0.457)

                                        0.086 Typ  0.376 Typ                                                     0.109                  0.103                           0.554
                                         (2.184)    (9.550)                                                     (2.769)                 (2.616)                        (14.072)

                                                                                                               0.070
                                                                                                               (1.778)

                                                                       SIDE VIEW

                                                   0.0027 Thk (0.069)  0.357 (9.068)                                                                                             A
                                                      0.032 (0.813)
                                                                                                                                                                                             0.088
                                                                                                                                                     16.526 (419.760)                       (2.235)

                                                   0.018 (0.457)       0.050 (1.270)
                                                      0.070 (1.778)    0.104 (2.642)

                                                   TRANSFER IMPEDANCE TEST                                               0.188 Pitch
                                                          PART NO. 97-636                                                      (4.775)

                                                                                                                         0.018 Slot
                                                                                                                              (0.457)

Shielding Effectiveness (dB)  140                                                                                                  "D" Lance         0.376
                              120                                                                                        0.047 (1.194) Semi-ellipse  (9.550)
                              100
                              80                                                                                            X 0.060 (1.524) wide
                              60
                              40        100K                  1M                     10M  100M         1G
                              20                                                                                                                                                                                                           A

                               0
                                   10K

                                                                     Frequency (Hz)

                                        -- Frequency vs. Shielding Effectiveness @ 50% Comp

All dimensions shown are in inches (millimeters) unless otherwise specified.

26

                     www.lairdtech.com
EMI ESSENTIALS

FINGERSTOCK
NO SNAG GASKET

Part No. 77-079, 83, 84, 85, 86, 91, 92                                                                                         Part No. 77-012, 14, 33, 78, 81, 82

LLaaiirrdd TTeecchhnnoololgoigesieNsoNSonaSgnSaegrieSsesrhieiesldsinhgiegldasinkegtsgoafsfekretthseodfefesirgntherea low        NO SNAG GASKET DIMENSIONS
dceosmigpnreesrsioanl,onwo scnoamg pderesisgsni.oPnr,onviodesdnwaigthdSetiscikgynF.inPgreorvsidseedlf-wadihthesSivteictkaype,
Ftihnegseerbserylslieulmf-acdophpeesrivsehietaldpineg, tghaeskseetsbperroyvlildiuemeacsyopanpderseschuireeldminougnting.       SERIES  A  B  C            D                      E        H           M       APPROX.
                                                                                                                                                                                                     RADIUS     LENGTH
gaSskheietlsdipngroevfifdecetieveanseyssanofd>se1c0u0redbm(7o7u-n0t1in2)ga.nd 80 dB (77-014)                                   77-012 0.320 0.110 0.002 0.187                    0.018    0.210     0.110      24.000
fSohr iael1d0in0gMeHfzfepcltainveenweasvseof > 100 dB (77-012) and 80 dB                                                                   (8.128) (2.794) (0.051) (4.750)      (0.457)  (5.334)   (2.794)   (609.600)
E(a7s7y-,0co1s4t-)effoferctaiv1e 0in0stMallHatziopnlasinnceewfaasvteeners are not required
                                                                                                                                * 77-014 0.600 0.220 0.004 0.375                  0.032    0.280      0.180     24.000
IEdaeasly,ascoasnt-aellf-fpeucrtpioveseincosntatallcattsiotrnip sfionrcmeeftaasl tceanbeinrestsaraendnoeltecrterqonuiicred                 (15.240) (5.588) (0.102) (9.525)    (0.813)  (7.112)   (4.572)   (609.600)
eIdncelaolsuarsesan all-purpose contact strip for metal cabinets and
Aevleacilatrboleniicn eanwcildoesuvarerisety of plated finishes, see page 1-11                                                77-033 0.370 0.130 0.002 0.250                    0.025    0.210     0.110      16.000
SAuvpapliileadbilnesitnanadawrdid24e.0v0a0riient.y(6o0f9.p6l0a0temdmf)ilneinsghthess,osr eoetheprasgpeeci1fie7d lengths                   (9.398) (3.302) (0.051) (6.350)      (0.635)  (5.334)   (2.794)   (406.400)
ForSluopapd/ldieedfleicntisotnadnadtaa,rdse2e4p.a0g0e02-in33. .(609.600 mm) lengths or other
                                                                                                                                * 77-078 0.800 0.320 0.004 0.375                  0.032    0.440      0.190     24.000
   specified lengths                                                                                                                          (20.320) (8.128) (0.102) (9.525)                       (4.826)   (609.600)
                                                                                                                                                                                  (0.813) (11.176)
                                                                                                                                                                                                      0.100     16.000
                                                                                                                                * 77-079 0.320 0.100 0.035 0.156                  0.018    0.210     (2.540)   (406.400)
                                                                                                                                              (8.128) (2.540) (0.889) (3.962)     (0.457)  (5.334)
                                                                                                                                                                                                     0.100      24.000
                                                                                                                                77-081 0.280 0.110 0.002 0.187                    0.018    0.180     (2.540)   (609.600)
                                                                                                                                             (7.112) (2.794) (0.051) (4.750)      (0.457)  (4.572)
                                                                                                                                                                                                      0.420     24.000
                                                                                                                                * 77-082 1.100 0.400 0.005 0.500                  0.040     0.780    (10.668)  (609.600)
                                                                                                                                              (27.940) (10.160) (0.127) (12.700)  (1.016)  (19.812)
                                                                                                                                                                                                      0.202     16.000
                                                                                                                                * 77-083 0.370 0.130 0.004 0.125                  0.025    0.100     (5.131)   (406.400)
                                                                                                                                              (9.398) (3.302) (0.102) (3.175)     (0.635)  (2.540)
                                                                                                                                                                                                      0.202     16.000
                               TOP VIEW                                                                                         * 77-084 0.370 0.130 0.004 0.250                  0.025    0.100     (5.131)   (406.400)
                                                                                                                                              (9.398) (3.302) (0.102) (6.350)     (0.635)  (2.540)
                                                                                                                                                                                                      0.295     18.000
                                                                              D Pitch              E                            * 77-085 0.600 0.220 0.004 0.375                  0.032    0.150     (7.493)   (457.200)
                                                                                                                                              (15.240) (5.588) (0.102) (9.525)    (0.813)  (3.810)
                                                                                                   Slot                                                                                               0.100     16.000
                                                                                                                                                                                                     (2.540)   (406.400)
                                                                                                                                * 77-086 0.320 0.090 0.003 0.187                  0.018    0.210
                                                                                                                                              (8.128) (2.286) (0.762) (4.750)     (0.457)  (5.334)    0.150     18.000
                                                                                                                                                                                                     (3.810)   (457.200)
                                                                                                                                * 77-091 0.600 0.220 0.004 0.375                  0.032    0.780
                                                                                                                                              (15.240) (5.588) (0.102) (9.525)                        0.150     18.000
                                                                                                                                                                                  (0.813) (19.812)   (3.810)   (457.200)

                                  Length                                                                                        * 77-092 0.600 0.220 0.004 0.187                  0.032    0.295
                                                                                                                                              (15.240) (5.588) (0.102) (4.750)    (0.813)  (7.493)

                                                                                                                                * Available in UltraSoft low compeession version as -78.

              SIDE VIEW                                    SIDE VIEW
   77-012/014/033/078/081/082                77-079/083/084/085/086/091/092

   B     Double                                                                        B     Double

         Adhesive                                                                            Adhesive

         Transfer                                                                            Transfer

         Tape                                                                                Tape

      H                                                                                   H

M                                         M

                               A                                                                   A

C                                         C

All dimensions shown are in inches (millimeters) unless otherwise specified.

                                                                                                                                                                          27

www.lairdtech.com
    EMI ESSENTIALS

    FINGERSTOCK
    ALL-PURPOSE SERIES

                                                                                                                                                                                                                                          Right angle  Strips available
                                                                                                                                                                                                                                       versions available with Magnefil

                                                                                                                                                                                                                                          Right angle  Strips available
                                                                                                                                                                                                                                       versions available with Magnefil

                                                                                                                                                                                                                                                          Strips supplied with
                                                                                                                                                                                                                                                       teardrop

                                  97-537                                                      97-536                                              97-538                                                  97-500                       97-520      Strip9s 7su-p5p4lie0d with
                                       97-545                                                 97-536                                                   97-535                                               97-505                       97-525  teardrop 97-544
                                                                                                                                                        97-548                                                97-510
                                  97-537                                                                                                                                                                                               97-520          97-540
                                       97-545                                                                                                     97-538                                                  97-500                         97-525          97-544
                                                                                                                                                       97-535                                              97-505
                                                                                                                                                        97-548                                                97-510

                                                                                                                                                                                                                                                 Patent No. 3,504,095

                        These versatile gaskets are made from high-                                                                               Strips 97-500 and 97-538 are furnished in standard lengths of
                        performance beryllium copper with Sticky Fingers                                                                         24.000 in. (609.600 mm) and in continuous 25.0 fPta.t(e7n.t6Nmo. )3,c5o0i4ls,0.95
                                                                                                                                                  Series 97-520 and 97-540 are supplied in standard 16.000 in.
                        self-adhesive backing. They provide an extremely                                                                          (406.400 mm) lengths and in 25.0 ft. (7.6 m) coils. Strips 97-537,
                                                                                                                                                  97-535 and 97-545 are supplied in 12.000 in. (304.800 mm) lengths.
                        tight, instant bond and are ideal as an all-purpose                                                                       All are available in your choice of finishes, see page 17.
                                                                                                                                                  Please note that designated strips are available with Magnefil,
                        contact strip for metal cabinets and electronic                                                                           a rubber strip filled with magnetic absorbing particles and inserted
                                                                                                                                                  within the curve of the fingers. Magnefil provides increased magnetic
                        enclosures, particularly where space is critical.                                                                         field shielding.
                                                                                                                                                  These 97-Series products are also available in UltraSoft low
    Magnetic field shielding effectiveness of these strips has been proven                                                                        compression force 98-Series.

    to be > 46 dB for a 14 kHz plane wave and 108 dB for a 10 GHz

    plane wave. When tested per MIL-STD-285 for electromagnetic

    shielding, these strips showed superior performance under minimum

    compression. They proved to be especially effective where variations

    exist in the space to be shielded and in applications that require high

    shielding performance despite frequent opening and closing of the

    cabinet.                                                                                  ALL-PURPOSE SERIES

                                                                                              SERIES A               B              C                D              E          F   G                      H        I                J  K         L APPROX. APPROX.

                                                                                                            MIN.                                   0.D375         0.E032                                                                               LENGTH COIL
                                                                                                                                                  (9.525)        (0.813)
                                  J                                                           ALL-PURPOSE SERIES                                                                                                                                       FT (M)
                                                                                                                                                   0.375          0.032
                                                                                              S9E7R-5IE0S0 0.A600 0.B230 0.C004                   (90..532755)   (00..801332)   0.F380 0G.310 0H.500 0I.080                         NJ /A 0K.770 0L.040 AP2P4R.O00X0. APP2R5O.0X.
                                                                                                         (1M5.I2N4.0) (5.842) (0.102)             (9.525)        (0.813)       (9.652) (7.874) (12.700) (2.032)                     -- (19.558) (1.016) (L6E0N9G.6T0H0) C(7O.I6L)
                                                                                                                                                   0.375          0.032
                               A  J                                                           97-505   0.600          0.230          0.004        (90..532755)   (00..801332)   0.380 0.310                N/A     0.080 0.500 0.770 0.040 24.000 FT2(5M.0)
                                                                                              97-500  (105.6.20400)  (05..283402)   (00..010042)  (9.525)        (0.813)       (90..635820) (70..837140)  0.--500  (02..008302) (1N2./7A00) (109.7.57508) (01..004106) (62049.0.60000) 2(75..60)
                        C                                                                     97-510  (15.240)       (5.842)        (0.102)        0.250          0.022        (9.652) (7.874) (12.700) (2.032) -- (19.558) (1.016) (609.600) (7.6)
                                                                                              97-505                  0.230          0.004        (60..335705)   (00..505392)
                        C      A     B                                                        97-520   0.600         (05..283402)   (00..010042)  (9.525)        (0.813)        0.380 0.310 0.500 0.080 N/A 0.770 0.040 24.000 25.0
       Tip Touches                                                                            97-510  (105.6.20400)  (5.842)        (0.102)        0.250          0.022        (90..635820) (70..837140) (12N.7/A00) (20..003820) 0.5--00 (109.7.57508) (01..004106) (62049.0.60000) 2(75..60)
       Mounting Surface                                                                       97-525  (15.240)        0.140          0.003        (60..325500)   (00..505292)  (9.652) (7.874) -- (2.032) (12.700) (19.558) (1.016) (609.600) (7.6)
                                                                                              97-520                 (03..253506)   (00..007064)  (6.350)        (0.559)
                               Double AdhesiveB                                               97-527   0.370         (5.842)        (0.102)        0.125          0.025         0.250 0.090 0.310 0.060                             N/A 0.500 0.070 16.000 25.0
                               Transfer Tape                                                  97-525  (09..630908)    0.140          0.003        (30..127550)   (00..603252)  (60..335800) (20..238160) (70..857040) (10..502840)  N--/A (102.7.77000) (01..074708) (42046.0.40000) 2(75..60)
                                                                                              97-535  (15.240)       (03..154506)   (00..007063)  (6.350)        (0.559)       (9.652) (7.874) (12.700) (2.032)                     -- (19.558) (1.016) (609.600) (7.6)
                                                                                              97-527   0.370         (3.556)        (0.076)        0.375          0.040
       Tip Touches             Double Adhesive                                                97-536  (09..337908)    0.055          0.002        (90..512255)   (10..001265)   0.250 0.090 N/A 0.060 0.320 0.500 0.070 16.000 25.0
       Mounting Surface        Transfer Tape                                                  97-535  (9.398)        (01..134907)   (00..005013)  (3.175)        (0.635)       (60..325500) (20..208960) 0.--310 (01..056204) (8N.1/A28) (102.5.70000) (01..077708) (41066.0.40000) 2(75..60)
                                                                                              97-537   0.280         (3.556)        (0.076)        0.375          0.040        (6.350) (2.286) (7.874) (1.524) -- (12.700) (1.778) (406.400) (7.6)
           E                                                                                  97-536  (07..317102)    0.250          0.005        (90..532755)   (10..001460)
                                                   CL of Finger                               97-538  (9.398)        (06..035550)   (00..010227)  (9.525)        (1.016)         N/A N/A                  0.183 N/A N/A 0.300 0.040 16.000 N/A
                                                                                              97-537   0.780         (1.397)        (0.051)        0.500          0.040         0.--250 0.--090           (4N.6/A48) 0.0--60 0.3--20 (07..560200) (01..007106) (41066.0.40000) 25--.0
                                                                                              97-540  (109.2.88102)   0.310          0.004        (102.3.77050)  (01..004106)  (6.350) (2.286)
                                                                                              97-538  (7.112)        (07..285704)   (00..010052)  (9.525)        (1.016)                                   -- (1.524) (8.128) (12.700) (1.778) (406.400) (7.6)
                                                                                              97-544   0.670         (6.350)        (0.127)        0.375          0.040
                                                                                              97-540  (107.7.08108)   0.410          0.007        (90..552050)   (10..001460)  0.380 0.380 N/A 0.140 0.480 0.940 0.080 12.000 25.0
                                                                                              97-545  (19.812)       (100.3.41104)  (00..010748)  (12.700)       (1.016)       (9N.6/5A2) (9N.6/A52) 0.1--83 (3N./5A56) (1N2/.A192) (02.33.08076) 0(2.0.04302) (1360.40.08000) N(7/A.6)
                                                     CL of Finger                             97-544   1.130         (7.874)        (0.102)        0.188          0.018        --  -- (4.648) --                                    -- (7.620) (1.016) (406.400) --
                                                F                                             97-548  (208.6.77002)   0.250          0.005        (40..737755)   (00..405470)
                                                                                              97-545  (17.018)       (06..431500)   (00..010277)  (9.525)        (1.016)
           E                                                                                           0.780         (10.414)       (0.178)        0.188          0.018         0.380 0.380 0.530 0.140 N/A 0.940 0.140 24.000 25.0
       D                                                                                              (119.1.83102)   0.110          0.003        (40..717858)   (00..405178)  (90..635820) (90..635820) (13N.4/A62) (30..515460) 0.4--80 (203.9.84706) (03..058506) (61029.0.60000) 2(75..60)
                                                                                                      (28.702)       (02..275904)   (00..007065)  (4.775)        (0.457)       (9.652) (9.652) -- (3.556) (12.192) (23.876) (2.032) (304.800) (7.6)
                                                F                                                      0.280         (6.350)        (0.127)        0.500          0.040
                                                                                                      (07..718102)                                (102.1.78080)  (01..001186)   0.500 0.560 0.780 0.140 N/A 1.940 0.100 12.000 N/A
       D                                                                                              (19.812)        0.110          0.003        (4.775)        (0.457)       (102.3.78000) (104.3.28204) (109.5.83102) (03..154506) N--/A (409.9.24706) (02..154400) (32044.0.80000) 25--.0
                                                                                                                     (02..171904)   (00..007063)   0.375          0.040        (9.652) (9.652) (13.462) (3.556) -- (23.876) (3.556) (609.600) (7.6)
    I                      G                                                                           0.260         (2.794)        (0.076)       (90..552050)   (10..001460)
                                                                                                      (06..268004)                                (12.700)       (1.016)         0.380 0.380 0.530 0.140 N/A 0.940 0.080 24.000 25.0
                        H                                                                             (7.112)         0.410          0.007                                     (90..655020) (90..655620) (103..748602) (30..515460) N--/A (213.9.84706) (02..100302) (61029.0.60000) N(7/.A6)
                                                                                                                     (100.1.41104)  (00..010738)                               (12.700) (14.224) (19.812) (3.556) -- (49.276) (2.540) (304.800) --
                                                                                                       1.130         (2.794)        (0.076)
    I                      G                                                                          (208.2.76002)                                                             0.190 0.080 0.230 0.060                             N/A 0.370 0.065 16.000 25.0
                            K                                                                         (6.604)         0.250          0.005                                     (40..832860) (20..033820) (50..854320) (10..512440)  N--/A (09..934908) (01..068501) (42046.0.40000) 2(75..60)
                        H                                                                                            (06..431500)   (00..010277)                               (9.652) (9.652) (13.462) (3.556)                     -- (23.876) (2.032) (609.600) (7.6)
                                                   L                                                   0.780         (10.414)       (0.178)
                                                                                                      (119.1.83102)
                           K                                                                          (28.702)                                                                  0.190 0.080 N/A 0.060 0.240 0.370 0.065 16.000 25.0
                                                                      L                                                                                                        (40..812960) (20..003820) 0.--230 (01..056204) (6N.0/A96) (09..337908) (01..066551) (41066.0.40000) 2(75..60)
                                                                                                                                                                               (4.826) (2.032) (5.842) (1.524) -- (9.398) (1.651) (406.400) (7.6)

                                                   Smallest                                                                                                                     0.500 0.560 N/A 0.140 0.750 1.940 0.100 12.000 N/A
                                                   Opening                                                                                                                     (102.1.79000) (104.0.28204) N--/A (03..056506) (109.2.04500) (409.3.27706) (02..056450) (31064.0.80000) 25--.0
                                                                                                                                                                               (4.826) (2.032) -- (1.524) (6.096) (9.398) (1.651) (406.400) (7.6)

              Mounting                                                                                                                                                           0.380 0.380 0.530 0.140 N/A 0.940 0.080 24.000 25.0
               Surface                                                                                                                                                         (90..655020) (90..655620) (13N.4/A62) (30..515460) 0.7--50 (213.9.84706) (02..100302) (61029.0.60000) N(7/.A6)
                                                                                                                                                                               (12.700) (14.224) -- (3.556) (19.050) (49.276) (2.540) (304.800) --
                                                                                 Smallest
    All dimensionMsosuhnotwinngare in inches (millimeters) unless othOeprwenisiengspecified.  97-548 0.780 0.250 0.005 0.375 0.040 0.380 0.380 0.530 0.140                                                                          N/A 0.940 0.080 24.000 25.0
                                                                                                        (19.812) (6.350) (0.127) (9.525) (1.016) (9.652) (9.652) (13.462) (3.556)                                                   -- (23.876) (2.032) (609.600) (7.6)
                     Surface

    All dimensions shown are in inches (millimeters) unless otherwise specified.

28

              www.lairdtech.com
EMI ESSENTIALS

FINGERSTOCK
CLIP-ON SERIES

                                             97-603                                                     97-610          97-611                    97-612           97-616                              97-618
                                             97-604                                                     97-614          97-613                                     97-619                              97-621
                                             97-605                                                                     97-615                                     97-620                              97-622
                                             97-606                                                                     97-627                                     97-624                              97-623
                                             97-607
                                                                                                                                                                   979-76-16650                       97-618
                                                                                                                                                                   97-619                             97-621
                                                                                                                                                                   97-620                             97-622
                                                                                                                                                                   97-624                             97-623

                     97-628                  97-603         97-631                                      97-610           97-611             97-612                  97-650
                     97-629                  97-604         97-632                                      97-614  97-640 97-613       97-645
                     97-630                  97-605         97-633                                                                  97-646
                                             97-606         97-634                                                       97-615
                     97-628                  97-607                                                                      97-627
                     97-629
                     97-630                                 97-631                                              97-640           97-645
                                                            97-632                                                               97-646
                                                            97-633
                                                            97-634

This series from Laird Technologies is designed for use where high                                                      MINI CLIP-ON
temperature or other design considerations preclude the use of
adhesive-mounted gasketing. Yet it provides the same shielding                                                          Laird Technologies' Mini Clip-On (97-645/646) Gaskets are
characteristics and effectiveness as on Sticky Fingers mounted
series. Clip-On Gaskets offer shielding effectiveness >100 dB for                                                       designed for use on today's thinner, lighter materials.
100 MHz plane wave. All are available in your choice of finishes,
see page 17.                                                                                                             Lowest compression force available in clip-on configuration
These 97-Series products are also available in UltraSoft low
compression force 98-Series.                                                                                             Virtually no compression set 100% recovery of original height
SNAP-TITE WITH "D" LANCE
                                                                                                                           at up to 60% compression

                                                                                                                         "D" lance for extra holding power

                                                                                                                         Optimum conductivity and mechanical properties of

                                                                                                                           beryllium copper

This configuration has been designed specifically to provide out-                                                         High  cycle        life     50,000  cycles  without  fracture,              wear,
standing holding power. "D" lances snap into drilled or punched                                                                           
holes in the mounting surface to create a strong omnidirectional
grip with excellent conductivity.                                                                                          or compression set
GRIP-TITE WITH "T" LANCE
                                                                                                                                                                                    

Ideal for use with softer materViaIlEsW, su1ch as aluminum or plated                                                                                            VIEW 2

plastic. "HT" lanBces bite into the mounting surfa0c.1e00and (2.540) preserve                                                    Smallest                B

                                                F                                                                                Opening H                                                               F
                                                         G                                                                                                                                                           G
elecSOtmrpieacnlaleinslgtconductivity.                                                   "D" Lance
                                                                                   Recommended

                                                                                   Hole Size

E                                                                                                                                A                E                D

                              A                 VIEW 1                                                                                                          VIEW 2
                          B
        DH                                             F                                             J  CL of Hole               Smallest               B
                                                                G                     0.100 (2.540)      Radius
  SAmllallest                                                                                                                    Opening H                  C*
OtOhpeersning C*                             "D" LANCE DETAIL                            "D" Lance                                                                                                    F
                                                                                   Recommended
          E(Inside)                                                                                                                                  CLIP-ON SERIES 97-603/604/605/606/607                      G
                                                                                          Hole Size

                                                                                                                                 A                E             D

                     A                                                                                                                                          VIEW 3

                                                                                   J                    CL of Hole                            CL                                                                           B
                                                                                                         Radius
        D                                    0.080                                                                                                       I C*                                                                    E

  All                                        (2.032)
Others C*
                                             "DK" LANCE DETAIL                                                                                    CLIP-ON SERIES 97-603/604/605/606/607
           (Inside)
                                 I                                 0.050 (1.270)                                                                                        D        *Variations in the
                                                                   Semi-ellipse
                                    0.100                                                                                                                                           clip-on area are     A                              D
                                                                                                                                                                VIEW 3           available. Consult                              J
                                    (2.540)
                                                                                                                                                                                 sales department.

                                 C0L.0I8P0-ON SERIES                                                                                          CL                                                                        B
   97-610/611/612/613/614(/26.01352)/616/618/619/620/621/622/623/624
                                                                                                                                 G                                                                          C*                E

                                                                                                                                                     FI

                     97-627/628/629/630/631/632/633/634/640                                                                                                 MINI CLIP-ON 97-645/646

                                 I           K                     0.050 (1.270)                                                                                        D        *Variations in the
                                                                   Semi-ellipse
All dimensions shown are in inches (m0i.l1li0m0eters) unless otherwise specified.                                                                                                   clip-on area are     A                           D
                                                                                                                                                                                 available. Consult                           J
                                    (2.540)
                                                                                                                                                                                 sales department.

                                 CLIP-ON SERIES                                                                                  G                                                                       C*
   97-610/611/612/613/614/615/616/618/619/620/621/622/623/624
                                                                                                                                                     F
                97-627/628/629/630/631/632/633/634/640
                                                                                                                                                            MINI CLIP-ON 97-645/646

All dimensions shown are in inches (millimeters) unless otherwise specified.

                                                                                                                                                                          29

www.lairdtech.com
          EMI ESSENTIALS

          FINGERSTOCK
          CLIP-ON SERIES

    CLIP-ON SERIES DIMENSIONS

                                                                                                 NO LANCE SQUARE  GRIP-TITE SNAP-TITE LANCE LOCATIONS LANCE TO BODY STYLE

                                                                                                      LANCE       "T"LANCE "D"LANCE DIMENSIONS LANCE DIMS.

    VIEW  SERIES     A      B  C             D  E              F        G       H APPROX. NL          SQ          GT  ST  I   J        K                    SLOT SOL.
       2   97-603
                   0.380                                      0.250     0.040   LENGTH
                   (9.652)                                    (6.350)  (1.016)
                            0.200 0.100      0.330 0.005                        0.060 16.000     --   --          --  X   0.250 0.099  0.500                X--
                            (5.080) (2.540)  (8.382) (0.127)
                                                                                (1.524) (406.400) --  --          --  --  (6.350) (2.515) (12.700)          ----

    2 97-604 0.330 0.280 0.070 0.380 0.005 0.250 0.040 0.100 16.000                              --   --          X   --  0.230 0.204  0.500                X--

                   (8.382) (7.112) (1.778) (9.652) (0.127) (6.350) (1.016) (2.540) (406.400) --       --          --  --  (5.842) (5.182) (12.700)          ----

    2 97-605 0.380 0.200 0.070 0.380 0.005 0.250 0.040 0.060 16.000                              --   --          X   --  0.230 0.204  0.500                X--

                   (9.652) (5.080) (1.778) (9.652) (0.127) (6.350) (1.016) (1.524) (406.400) --       --          --  --  (5.842) (5.182) (12.700)          ----

    2 97-606 0.380 0.200 0.070 0.380 0.005 0.250 0.040 0.060 16.000                              --   --          --  X   0.250 0.161  0.500                X--

                   (9.652) (5.080) (1.778) (9.652) (0.127) (6.350) (1.016) (1.524) (406.400) --       --          --  --  (6.350) (4.089) (12.700)          ----

    2 97-607 0.330 0.280 0.070 0.380 0.005 0.250 0.040 0.100 16.000                              --   --          --  X   0.250 0.161  0.500                X--

                   (8.382) (7.112) (1.778) (9.652) (0.127) (6.350) (1.016) (2.540) (406.400) --       --          --  --  (6.350) (4.089) (12.700)          ----

    1 97-610 0.300 0.100 0.070 0.190 0.005 0.187 0.047 0.065 16.000                              X    --          #   #   --  --       --                   --  X

                   (7.620) (2.540) (1.778) (4.826) (0.127) (4.750) (1.194) (1.651) (406.400) --       --          --  --  --  --       --                   ----

    1 97-611 0.300 0.100 0.070 0.190 0.005 0.182 0.047 0.060 16.000                              --   --          X   --  0.364 0.062  0.728                X--

                   (7.620) (2.540) (1.778) (4.826) (0.127) (4.623) (1.194) (1.524) (406.400) --       --          --  --  (9.246) (1.575) (18.491)          ----

    1 97-612 0.440 0.100 0.070 0.190 0.003 0.187 0.047 0.045 16.000                              #    X           --  --  0.093 0.050  0.750                X--

                   (11.176) (2.540) (1.778) (4.826) (0.076) (4.750) (1.194) (1.143) (406.400) --      --          --  --  (2.362) (1.270) (19.050)          ----

    1 97-613 0.300 0.100 0.070 0.190 0.005 0.182 0.047 0.060 16.000                              --   --          --  X   0.364 0.054  0.728                X--

                   (7.620) (2.540) (1.778) (4.826) (0.127) (4.623) (1.194) (1.524) (406.400) --       --          --  --  (9.246) (1.372) (18.491)          ----

    1 97-614 0.300 0.100 0.050 0.190 0.005 0.187 0.047 0.065 16.000                              X    --          #   #   --  --       --                   --  X

                   (7.620) (2.540) (1.270) (4.826) (0.127) (4.750) (1.194) (1.651) (406.400) --       --          --  --  --  --       --                   ----

    1 97-615 0.297 0.100 0.050 0.187 0.005 0.182 0.047 0.050 16.000                              --   --          --  X   0.364 0.309  0.728                --  X

                   (7.544) (2.540) (1.270) (4.750) (0.127) (4.623) (1.194) (1.270) (406.400) --       --          --  --  (9.246) (7.849) (18.491)          ----

    1 97-616 0.420 0.120 0.100 0.250 0.005 0.187 0.047 0.095 16.000                              X    --          --  --  --  --       --                   --  X

                   (10.668) (3.048) (2.540) (6.350) (0.127) (4.750) (1.194) (2.413) (406.400) --      --          --  --  --  --       --                   ----

    1 97-618 0.420 0.140 0.060 0.210 0.005 0.187 0.047 0.080 16.000                              --   --          --  X   0.500 0.065  1.000                --  X

                   (10.668) (3.556) (1.524) (5.334) (0.127) (4.750) (1.194) (1.778) (406.400) --      --          --  --  (12.700) (1.651) (25.400)         ----

    1 97-619 0.440 0.080 0.050 0.190 0.005 0.187 0.047 0.045 16.000                              X    --          #   #   --  --       --                   --  X

                   (11.176) (2.032) (1.270) (4.826) (0.127) (4.750) (1.194) (1.143) (406.400) --      --          --  --  --  --       --                   ----

    1 97-620 0.440 0.080 0.070 0.190 0.005 0.187 0.047 0.045 16.000                              X    --          #   #   --  --       --                   --  X

                   (11.176) (2.032) (1.778) (4.826) (0.127) (4.750) (1.194) (1.143) (406.400) --      --          --  --  --  --       --                   ----

    1 97-621 0.440 0.120 0.070 0.230 0.005 0.193 0.046 0.070 16.000                              --   --          X   --  0.652 0.084  1.351                X--

                   (11.176) (3.048) (1.778) (5.842) (0.127) (4.902) (1.168) (1.778) (406.400) --      --          --  --  (16.561) (2.134) (34.315)         ----

    1 97-622 0.440 0.120 0.070 0.190 0.005 0.193 0.046 0.075 16.000                              --   --          --  X   0.290 0.060  0.725                X--

                   (11.176) (3.048) (1.778) (4.826) (0.127) (4.902) (1.168) (1.905) (406.400) --      --          --  --  (7.366) (1.524) (18.415)          ----

    1 97-623 0.420 0.080 0.070 0.187 0.005 0.187 0.047 0.045 16.000                              --   --          --  X   0.530 0.064  1.000                --  X

                   (10.668) (2.032) (1.778) (4.750) (0.127) (4.750) (1.194) (1.143) (406.400) --      --          --  --  (13.462) (1.626) ( 25.400)        ----

    1 97-624 0.420 0.140 0.060 0.210 0.005 0.187 0.047 0.080 16.000                              X    --          --  --  --  --       --                   --  X

                   (10.668) (3.556) (1.524) (5.334) (0.127) (4.750) (1.194) (2.032) (406.400) --      --          --  --  --  --       --                   ----

    1 97-627 0.297 0.099 0.070 0.187 0.005 0.187 0.047 0.049 16.000                              --   --          --  X   0.280 0.049  0.748                --  X

                   (7.544) (2.515) (1.778) (4.750) (0.127) (4.750) (1.194) (1.245) (406.400) --       --          --  --  (7.112) (1.245) (19.000)          ----

    1 97-628 0.600 0.210 0.100 0.230 0.005 0.187 0.047 0.070 16.000                              X    --          #   #   --  --       --                   --  X

                   (15.240) (5.334) (2.540) (5.842) (0.127) (4.750) (1.194) (1.778) (406.400) --      --          --  --  --  --       --                   ----

    1 97-629 0.600 0.210 0.050 0.190 0.005 0.187 0.047 0.070 16.000                              X    --          #   #   --  --       --                   --  X

                   (15.240) (5.334) (1.270) (4.826) (0.127) (4.750) (1.194) (1.778) (406.400) --      --          --  --  --  --       --                   ----

    1 97-630 0.600 0.210 0.070 0.190 0.005 0.187 0.047 0.070 16.000                              X    --          #   #   --  --       --                   --  X

                   (15.240) (5.334) (1.778) (4.826) (0.127) (4.750) (1.194) (1.778) (406.400) --      --          --  --  --  --       --                   ----

    1 97-631 0.600 0.210 0.070 0.190 0.005 0.182 0.047 0.080 16.000                              --   --          X   --  0.364 0.058  0.728                X--

                   (15.240) (5.334) (1.778) (4.826) (0.127) (4.623) (1.194) (2.032) (406.400) --      --          --  --  (9.246) (1.473) (18.491)          ----

    1 97-632 0.600 0.210 0.070 0.190 0.005 0.182 0.047 0.080 16.000                              --   --          --  X   0.364 0.058  0.728                X--

                   (15.240) (5.334) (1.778) (4.826) (0.127) (4.623) (1.194) (2.032) (406.400) --      --          --  --  (9.246) (1.473) (18.491)          ----

    1 97-633 0.600 0.210 0.050 0.190 0.005 0.182 0.047 0.080 16.000                              --   --          X   --  0.364 0.058  0.728                X--

                   (15.240) (5.334) (1.270) (4.826) (0.127) (4.623) (1.194) (2.032) (406.400) --      --          --  --  (9.246) (1.473) (18.491)          ----

    1 97-634 0.600 0.210 0.050 0.190 0.005 0.182 0.047 0.080 16.000                              --   --          --  X   0.364 0.058  0.728                X--

                   (15.240) (5.334) (1.270) (4.826) (0.127) (4.623) (1.194) (2.032) (406.400) --      --          --  --  (9.246) (1.473) (18.491)          ----

    1 97-640 1.090 0.260 0.070 0.280 0.005 0.375 0.040 0.060 16.000                              X    --          #   #   --  --       --                   --  X

                   (27.686) (6.604) (1.778) (7.112) (0.127) (9.525) (1.016) (1.524) (406.400)    --   --          --  --  --  --       --                   ----

    3 97-645 0.210 0.070 0.045 0.250 0.003 0.200 0.030 0.010 24.000                              --   --          --  X   0.485 0.133  1.000                X--

                   (5.334) (1.778) (1.143) (6.350) (0.076) (5.080) (0.762) (0.254) (609.600)     --   --          --  --  (12.319) (3.378) (25.400)         ----

    3 97-646 0.275 0.080 0.040 0.280 0.006 0.250 0.030 0.030 24.000                              --   --          --  X   0.500 0.143  1.000                --  X

                   (6.985) (2.036) (1.016) (7.112) (0.152) (6.350) (0.762) (0.762) (609.600) --       --          --  --  (12.700) (12.700) (25.400)        ----

    1 97-650 0.980 0.400 0.200 0.300 0.004 1.000 0.030 0.200 16.000                              #    #           --  --  0.192 0.120  0.486                X--

                   (24.892) (10.160) (5.080) (7.620) (0.102) (25.400) (0.762) (5.080) (406.400)  --   --          --  --  (4.877) (3.048) (12.344)          ----

                                                                                                                                       X Standard               # Optional

30

                   www.lairdtech.com
                                                                                                              EMI ESSENTIALS

                                                                                                              FINGERSTOCK
                                                                                                              LOW PROFILE HOOK-ON GASKET

                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          LaLiradirdTeTcehchnnoolologgiieess ooffffeerrssiittsslilnineeoof flolwowprpofriolefibleerbyelliruymlliucmoppceorpspheierldshinigelding

                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          finLfgianiegrrdesrTtsoetcochkcnk..oSlSiomimgippelseoifnfsestrtasallialtastitloionenisoisaf claoccowcmoppmrloipsfihliesdhbebdryylhbliouyomhkoicnogpkpoinengresoehnniedeldoeifnngd of

                                                                                                                                                                                                   77-071/77-072                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          tpdsmhLftpwpthiehuareinrriftpwptiglotpwptieeoeeLftpwptiitneigsehnehritehnrrhsahrrfusnrrcidileieeeolgiieolDgtseeoeggtaeistolaegnhrsradfuehashfcsTsfaupceunsgcmdpigseig,sitsolrseholtolrpaasueratpieaerueafauekaobsmcTmnemesim,kollrs,l,edrstersheicittiaestgketecob-ekamcrubkteobmkcmeslneedraeeadtciwetnaihs.cdiealos-anosou-ittt-kutouttedrkirienodaSrerndnrslicnnie.dfononondoo.wdoitnoinociianitsricmtgSrnihrnipslrgncoSrhnesncsltcioeitietooioivsattiiniisaiicmatmtptopcoptcemptoofaipetpgotiotivtieetwltvhniswrvinveepeiiioiptofaeooetacoeftoefesteaenhhlrhoenheehlnthanedsinfnfealteanueaefsaeeieaaaoaseshraafltoraqdisrtdtrpdddeedilnureereleeluenueetefpuehgdrrm,hhhsaqafsrsdaqaqrsrosdddpieeseteteirsbeeppleuetgpupuvoplvgiagaslrogpaissanmpiiisestetpioipiplactete-iinpappdlveostliilvvoolaldflamcmeiivieat(cmiomiececoetooclcetPtenioitefestiiseaifimeprinafahfnem(meeiSoto(l(feotPmnterl.tPtPmaee(nnattAinipinhioiipcpnSPohthTtnncsSSoottatsr.)heavthonhArr..neeeoSAuAionnyiToioaesyTwTaofeoessos)Avmhssrh))cvvhhohhuubpleaenbsiwoaecgseeoshw)woofeestscseumcpuoenahcuauuwhuusitoilwcgssriincggtcmolassoluttccfossluuuihuaeohhhkigaaaaicwghmhiiirapnmmprrsxnnntemsfisssc.afferkgmpahaeetlitkikggagaaaeiToipitpxrnestpcstcx.xseepesasch.ac.ihftlertpeheoatctlgTttieieorTdT-ossletirsredlssttoahsixerwhtnea.hakhf.hhcfco.hoiccnf-dteoioeoeTr--eeosoaeeeliwroobeafwvwtedttffhanfrdnotabnfhrfndecwooeerierieaeweit-dbchtaykasotretddtrtabwrhrcaybtahhehseirccreen.gohchykemleetchchykukreeleihteIirosiyltrttqdirrir.ghdruermeor.gh.nghmlemeofeuelsehIsoaemleuehIohdiIlaldeekoednuhdeueoasoionnnoaepscsirruceaedmisaesilunuckdcdteehksplaesuhmhnasaesiyhonignleinlililnreaideitileisnileslncptetceslnssliygegeoiiylciayonlgalpoulndnldlnisedndciseisnrnspgsonesseginoigsrngeueoieiutnteepuineuncfreenetmct.srtcaongiprouoegiegierhtarduleuseTtntfelieefrsrnafdehaeniprencarhadpepndrleefentdlsdeilietyenfdnoideeeiinwendeoch.drndnndcrfddrrlarfefbfduroiroaedIfidneweogfooewmdtwdcolcoredcrfridcos,harlrraoanidkereeoadriaimeaitelwwmtngmlrftsglolsshdrfairoshnosdhindkinaddmwhiaiglawciwsgggeslennwsinennycnnidtcicitcenihsieneeneetedddhodf.fer
                                                                                                                                                                                                   77-071/77-072                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          inianDpDauapulplaloaipclwlalaiacsttiaotbtanic-ocsdhnhwimsrmehewcenthnritoeetpnrsperaporlsavowpcivdaeiiepcdmseienamgsynaaboycentbsioolneinmaslginimtaegidgtae.sdgk.eatswkeitthwseitchurseerceutreentrieotne, nwthioicnh,
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           DwuaIDnahllucloiocaawhlrtptsaaoatbctrlalhi-octmdewhiesrmesnecetbxtniptiotr-randopaivwrrloiediwvdceiedtispieoriasnenglnaaeoalanscwsoetniiosalpinngnianeggrgatgsaokacesftaktieocwitnliwthaitseheecsauescreyurirenestreteantletlainotnio,nw,hwichhich
                                                                                                              FFI7IGG7UU7-R0R7EE7-01117/717/7-07S7-h02ie7ld2ing                                                                             Effectiveness Per MIL-STD-285                     (Mod.)                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      aIlnIlWanoclcwloioodsrwreppbsovoia-rrbdaariii-tteredetsiycsrteeoiecoxfxttnirptoarlnalawatwiwlinidwpgiediinpferigeinnrliaegsecahlateseiceoastnsilaoienrneelirantveoarifltaaocbillfeiatactotielimteaeateseyt eyinaossutyralgilnaatslivtoaannlliaction
                                                                                                                                                                                                                                                 (60% Compression)
                                                                                                                                                                                                          Shielding Effectiveness Per MIL-STD-285 (Mod.)
          130                                                                                                 Shielding Effectiveness (dB)                                                                                   (60% Compression)                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            InWWcInooidicrmdpoeeoprpvravaoaattirrrbeaiieseitletitetysyxoetorrfxeaftqprpwulaaliiatrwdietnemiidgnregefnilrnefteisialsneshieaseshsleienalserineraetarroevtafoailcvafaiablicitlilealaitttbeaolteemateseoyaestmiynyseionteuastlrtlaagyltolaiaolutvniraongniac lvanic
                                                                                                                 S hieldinSghiEefSlfhedicentligdvieEnfngfeesEcsftif(evdcetBin)vesesne(sdsB )(dB )                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         WccoOiWdomfemifdepvperaeaavrdttiaiiebbirtniiiyelliisttotyytyfaornprefedlqapqautluriaindritegrilmneefgmniengnfeiisttnnhsisteshsoefasr1ea6ra.e2v0aavi0laaibnlal.eb(l4teo1t1mo.4eme8et0eytmoyumoru)groagrlvacaluvntaictnoicyour
FIGFUIGRU11E23R001E 1                                                                                                                                                                                  ShieSlhdiienlgdinEfgfeEc(ft6fie0vc%(et6ni0veC%esonsmeCPsopesmrrePMpsesrrIieLoM-snSsIT)iLoD-nS-T)2D85-2(8M5o(Md.)od.)                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                cOoOdcmfoefffpesmeairrrpeteeiaddbtiiliibinnetiynlsisgttrtyaetahnqrnedudqairuaredirmrdelemlneetgnsntghtstshosf o1f61.260.020in0. (i4n1.1(4.41810.4m8m0) mormcu)totrocyuotutro
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           OyfdoAOfeeuvfrsfareeiirdlrdeaedeibdnslleiiesnrnteiangsdnttUahdlnelatdnradagSrtldoehfnltegnt(hg-s7th8os)fol1of6w1.26f0.o20r0cie0n.vine(4.rs1(i41o1n.418.408m0 mm)mo)rocructuttotyooyuorur
          111200                                                                                                                                                                                                                      77-71                                                                                                                                                                                                                  Double                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       dAeAdsvviearaseiiildlraaebbldellneelegiinntnhgUtUhltltraraSSooftft(-7(8-7) 8lo)wlofworcfeorvceersivoenrsion
       1111987654323210000000000000111987654321111198765432100987654321000000000003210000000000000000000000000                                                                                                                        7777--7721                                                                                                                                                                                                             DATATTrraoddaapuhnhnebesesfslfseeeiivvrree
       10 10                                                                                                                                                                                                                          77-72                                                                                                                                                                                                               DATTraodapTuhnDATTeaberasodpafspleeuhnievrbesefsleeivre

                                                                                                                                                                                                       7777--77771277--7712                       1000                                                                                                                10000                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                DAIvMAaviElaaNiblSaleIbOlieNnSiUnltUraltSraoSftoft(-7(8-7)8lo) wlowforfcoercveevrseirosnion
                                                                                                                                                                                                                                                  100F0requency                                                                                                       10000
                                                                                                                                                                                                                                                                            (MHz)                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                DIMENSIONS
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 SERIES A                  B                                                                                            C                                                 D                                                 E                                                H          M                                                 P APPROX. NO. OF
                                                                                                                                                                                                                                                          Frequency (MHz)
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          DIDMSEIREMIENSESNIOSINAOSNS B                                                                                                  C                                                 D                                                 E                                                H          M            P APLEPNROGXTH. NFION.GOEFRS
                                                                                                                                                                                                   00  Approximate                          1LLe0en0nF10grg0ett0qhFh0rueeqnuceyn(cMyH(Mz)Hz)                                                                          1001000000                                                            C                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           0.004                                             0.125                                             0.018                                            0.267      0.200       0.062 L1E6N.2G0T0H FIN1G30ERS
                                                                                                                                                                                                       Approximate                                                                                                                                                                 B                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          77-071 0.450 0.060

                                                                                                                                                                                                                                                                                                                                                                                                                                            C          M                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  SER7SI7EE-SR0I7E1S A(101.4.A45300) B(01..05B6204) C(00..01C0042) D(03.1.1D2755) E0(0.0.4E1587) H0(6.2.7H6872) M0(5.2.M00800) P0(1.0.56P725) APP(A14R6P1O.P12XR.04.O08X0N.) O.N1O3O0F. OF

                                                                                                                                                                                                                                                                                                                                                                                                                                     B                 M                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               (11.430) (1.524)                                                                                                    (0.102)                                           (3.175)                                        (00..04((0((00150000...8.7.0..440044)15511558778877))))(06..27((0((68680068...7.2.3..732373)28562859277927))))(05..20((0((55008055...0.02..00.2200)08800880000000))))(01..05((0(11(607101...2.50..55.0055)67766772552255))))(41L1E6((1(44(N.14421.L11164G110E6611.8110TN.2...202.44H.04G40)0880880T00000HF))))I1N3FG01I1EN133R3G00S0ERS
                                                                                                                                                                                                                                                                                                                                                                                                                                  BB                                                                                                                                                                                                                                 &